TkA01G506680 | RubberDandelionOmics

Gene overview

TkA01G506680

Reference: TK1151 Chr: Chr01 Coordinates: 126881324-126882055 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

390 bp · TkA01G506680|TK1151|cDNA

ATGGAGAAGGGTTGTGTAACAGCGGCGTTAACAACACACACGGCAGCACTATTACCACAAAGCTTCTTCGCCCAAAACCCTAACACCCATTTATCATTATTACATACCCAATCTAATACCAGAAGAAGTAAAACCATGCCATCGTTATCCATTAAAGCTTCTTCTTCTTTCAAGACGCAGACTTTGTCAAGCAATTGGGATGTACCCACATCGAATTACTCTGCTTCAGCTCCTGCTTGGATGCCCAAATTCGAAGAACT...

CDS

Download CDS FASTA

390 bp · TkA01G506680|TK1151|CDS

ATGGAGAAGGGTTGTGTAACAGCGGCGTTAACAACACACACGGCAGCACTATTACCACAAAGCTTCTTCGCCCAAAACCCTAACACCCATTTATCATTATTACATACCCAATCTAATACCAGAAGAAGTAAAACCATGCCATCGTTATCCATTAAAGCTTCTTCTTCTTTCAAGACGCAGACTTTGTCAAGCAATTGGGATGTACCCACATCGAATTACTCTGCTTCAGCTCCTGCTTGGATGCCCAAATTCGAAGAACT...

Protein

Download Protein FASTA

129 aa · TkA01G506680|TK1151|PROTEIN

MEKGCVTAALTTHTAALLPQSFFAQNPNTHLSLLHTQSNTRRSKTMPSLSIKASSSFKTQTLSSNWDVPTSNYSASAPAWMPKFEELDTTNMLLPVNESSLGSQVDDMSADFIISQFAVPRCKKMIKRI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G506680`
TK1151 ID	TkA01G506680
OH-1004 ID	LXL04_019613
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	92.200
Protein coverage (%)	TK1151 89.922 / OH-1004 63.043 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G506680

Location Chr01:126881324-126882055 (-)

Description Similar to CLPP3: ATP-dependent Clp protease proteolytic subunit 3, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g66670`	Cleaves peptides in various proteins in a process that requires ATP hydrolysis.	Modified Clp protease complex in the ClpP3 null mutant and consequences for chloroplast development and function in Arabidopsis.2013 · DOI: 10.1104/pp.113.215699

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019613 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006515 protein quality control for misfolded or incompletely synthesized proteins Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009368 endopeptidase Clp complex Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009532 plastid stroma Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009840 chloroplastic endopeptidase Clp complex Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0004176 ATP-dependent peptidase activity Molecular Function

GO:0004252 serine-type endopeptidase activity Molecular Function

GO:0051117 ATPase binding Molecular Function

KEGG gene cross-reference

ana:alr1238

ath:AT1G66670

ava:Ava_0547

syc:syc1584_c

syf:Synpcc7942_2525

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.949

Rank 1 · TkA01G506680 · TK1151

Nucleus0.070

Rank 2 · TkA01G506680 · TK1151

Mitochondrion0.029

Rank 3 · TkA01G506680 · TK1151

Cytoplasm0.018

Rank 4 · TkA01G506680 · TK1151

Cell membrane0.014

Rank 5 · TkA01G506680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SXJ6`	Arabidopsis thaliana	sp\|Q9SXJ6\|CLPP3_ARATH ATP-dependent Clp protease proteolytic subunit 3, chloroplastic	61.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card