TkA01G411000 | RubberDandelionOmics

Gene overview

TkA01G411000

Reference: TK1151 Chr: Chr01 Coordinates: 102526815-102527442 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

444 bp · TkA01G411000|TK1151|cDNA

ATGAAAGAGAAGAAAATTTCTAAACCCATTGCGGTTCAAGGCCTTATATATTGTAAATCCGGCGCTAAATTTATCCCACTTAAAGGAGCCACGGCAAGAATAACTTGTTTAGCAAGAAACCAAAAGGGATTGGAATTAGCACCATTCTCCGTCTCAAGTTGCCCAGCTGATGACAAGGGATACTTTTTAGCCAAACTGTCTCCTCCATCGACAAAGTATTTAAAGAATGCTCAGTGGGAGCTGAAAGAGTGCAAGGCGTT...

CDS

Download CDS FASTA

444 bp · TkA01G411000|TK1151|CDS

ATGAAAGAGAAGAAAATTTCTAAACCCATTGCGGTTCAAGGCCTTATATATTGTAAATCCGGCGCTAAATTTATCCCACTTAAAGGAGCCACGGCAAGAATAACTTGTTTAGCAAGAAACCAAAAGGGATTGGAATTAGCACCATTCTCCGTCTCAAGTTGCCCAGCTGATGACAAGGGATACTTTTTAGCCAAACTGTCTCCTCCATCGACAAAGTATTTAAAGAATGCTCAGTGGGAGCTGAAAGAGTGCAAGGCGTT...

Protein

Download Protein FASTA

147 aa · TkA01G411000|TK1151|PROTEIN

MKEKKISKPIAVQGLIYCKSGAKFIPLKGATARITCLARNQKGLELAPFSVSSCPADDKGYFLAKLSPPSTKYLKNAQWELKECKAFLENSPLKDCKVPSDINGGVKGAHIISASYHRLLKNANLYSLDPFFYTSGKPEVGSHNKRY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G411000`
TK1151 ID	TkA01G411000
OH-1004 ID	LXL04_002917
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 39.946 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G411000

Location Chr01:102526815-102527442 (+)

Description Similar to SRPP: Protein SEED AND ROOT HAIR PROTECTIVE PROTEIN

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g02270`	Contributes to cell wall structure in root hairs and seeds, especially in phosphate (Pi) deprivation conditions or in the presence of ethylene.	SRPP, a Cell Wall Protein is Involved in Development and Protection of Seeds and Root Hairs in Arabidopsis thaliana.2017 · DOI: 10.1093/pcp/pcx008 Enhancement of cell wall protein SRPP expression during emergent root hair development in Arabidopsis.2017 · DOI: 10.1080/15592324.2017.1368940 A cell-wall protein SRPP provides physiological integrity to the Arabidopsis seed.2019 · DOI: 10.1007/s10265-018-01083-6

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002917 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009723 response to ethylene Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009832 plant-type cell wall biogenesis Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010054 trichoblast differentiation Biological Process

GO:0010286 heat acclimation Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0048316 seed development Biological Process

GO:0071365 cellular response to auxin stimulus Biological Process

GO:0071369 cellular response to ethylene stimulus Biological Process

GO:0072732 cellular response to calcium ion starvation Biological Process

GO:0080147 root hair cell development Biological Process

KEGG gene cross-reference

ath:AT1G54970

ath:AT3G62680

ath:AT4G02270

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.800

Rank 1 · TkA01G411000 · TK1151

Cytoplasm0.089

Rank 2 · TkA01G411000 · TK1151

Endoplasmic reticulum0.072

Rank 3 · TkA01G411000 · TK1151

Cell membrane0.045

Rank 4 · TkA01G411000 · TK1151

Lysosome / Vacuole0.031

Rank 5 · TkA01G411000 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01190Pollen_Ole_e_112-113 aa

PF16852HHV-1_VABD52-72 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G411000	`PF01190`	Pollen_Ole_e_1	12	113	0.17	12.8
TkA01G411000	`PF16852`	HHV-1_VABD	52	72	0.19	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81417`	Arabidopsis thaliana	sp\|O81417\|SRPP_ARATH Protein SEED AND ROOT HAIR PROTECTIVE PROTEIN	45.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card