TkA01G130870 | RubberDandelionOmics

Gene overview

TkA01G130870

Reference: TK1151 Chr: Chr01 Coordinates: 33066364-33066681 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

318 bp · TkA01G130870|TK1151|cDNA

ATGTTATGTTTGCTGGTGCTGATGTGTTTCGGAGAGAAGCTTGACGAGCATCAAATCAACGAAATTTCTAGGGTACAACGTGAAATGTTGTTTAGAAACAGATTGAAAGAGTTCGAGCAATTGCATGAAAATAGAGAAGATGTGTTGATTCCCCTCATCCAATCTCGAATCGAAGCAACCAAATCAAAACCGCAATTTGAAGACGATCGAATCGTGGTGTACGTTGACACTCTGGTAAATCTACAGCTTCCGGAGGAAGA...

CDS

Download CDS FASTA

318 bp · TkA01G130870|TK1151|CDS

ATGTTATGTTTGCTGGTGCTGATGTGTTTCGGAGAGAAGCTTGACGAGCATCAAATCAACGAAATTTCTAGGGTACAACGTGAAATGTTGTTTAGAAACAGATTGAAAGAGTTCGAGCAATTGCATGAAAATAGAGAAGATGTGTTGATTCCCCTCATCCAATCTCGAATCGAAGCAACCAAATCAAAACCGCAATTTGAAGACGATCGAATCGTGGTGTACGTTGACACTCTGGTAAATCTACAGCTTCCGGAGGAAGA...

Protein

Download Protein FASTA

105 aa · TkA01G130870|TK1151|PROTEIN

MLCLLVLMCFGEKLDEHQINEISRVQREMLFRNRLKEFEQLHENREDVLIPLIQSRIEATKSKPQFEDDRIVVYVDTLVNLQLPEEDGNNENGGKLTDKEMIWGF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G130870`
TK1151 ID	TkA01G130870
OH-1004 ID	LXL04_004607
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 40.541 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G130870

Location Chr01:33066364-33066681 (+)

Description Similar to CYP89A2: Cytochrome P450 89A2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g64900`	Cytochrome P450 89A2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004607 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0015996 chlorophyll catabolic process Biological Process

GO:0019395 fatty acid oxidation Biological Process

GO:0033310 chlorophyll a catabolic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0003958 NADPH-hemoprotein reductase activity Molecular Function

GO:0004497 monooxygenase activity Molecular Function

GO:0005506 iron ion binding Molecular Function

GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Molecular Function

KEGG gene cross-reference

ath:AT1G64900

ath:AT3G03470

ath:AT5G04660

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.357

Rank 1 · TkA01G130870 · TK1151

Endoplasmic reticulum0.198

Rank 2 · TkA01G130870 · TK1151

Nucleus0.146

Rank 3 · TkA01G130870 · TK1151

Peroxisome0.128

Rank 4 · TkA01G130870 · TK1151

Mitochondrion0.109

Rank 5 · TkA01G130870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11124Pho864-78 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G130870	`PF11124`	Pho86	4	78	0.056	13.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q42602`	Arabidopsis thaliana	sp\|Q42602\|C89A2_ARATH Cytochrome P450 89A2	40.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card