LXL04_038238 | RubberDandelionOmics

Gene overview

LXL04_038238

Reference: OH-1004 Chr: Chr09 Coordinates: 34909160-34909684 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

525 bp · LXL04_038238|LXL04_038238|OH1004|cDNA

ATGGAAGAAAATTCCTCCGACGAGATCCGAGCTCCACTCATACAAGCTGCTCCCTATAACGACGGCGATGACATTCTTCCGTCATCCTCATCACCGTCGGAGGTCGTGACGGTGCTGAAAGACGAGGAGGAGGAGAATTCTCCGATCAAGCAGGTTGCGTTGACCGTACCTACCACCGACGATGCATCTCTTCCTGTTCTCACCTTCCGAATGTGGGTACTCGGAACGCTTTCCTGCGCCCTTTTGTCGTTCCTCAATCA...

CDS

Download CDS FASTA

525 bp · LXL04_038238|LXL04_038238|OH1004|CDS

ATGGAAGAAAATTCCTCCGACGAGATCCGAGCTCCACTCATACAAGCTGCTCCCTATAACGACGGCGATGACATTCTTCCGTCATCCTCATCACCGTCGGAGGTCGTGACGGTGCTGAAAGACGAGGAGGAGGAGAATTCTCCGATCAAGCAGGTTGCGTTGACCGTACCTACCACCGACGATGCATCTCTTCCTGTTCTCACCTTCCGAATGTGGGTACTCGGAACGCTTTCCTGCGCCCTTTTGTCGTTCCTCAATCA...

Protein

Download Protein FASTA

174 aa · LXL04_038238|LXL04_038238|OH1004|PROTEIN

MEENSSDEIRAPLIQAAPYNDGDDILPSSSSPSEVVTVLKDEEEENSPIKQVALTVPTTDDASLPVLTFRMWVLGTLSCALLSFLNQFFWYRTEPLSITAISAQIAVVPLGQLMAARITDRVFFKGSRWELTMMNPGPFNVKEHVLITIFANSGAGTVYDGVMVRMYFVLKHNH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038238`
TK1151 ID	TkA04G408460
OH-1004 ID	LXL04_038238
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038238

Location Chr09:34909160-34909684 (-)

Description Similar to OPT7: Oligopeptide transporter 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g10770`	Involved in the translocation of tetra- and pentapeptides across the cellular membrane in an energy-dependent manner.	AtOPT6 transports glutathione derivatives and is induced by primisulfuron.2004 · DOI: 10.1104/pp.104.039859
`At5g53510`	May be involved in the translocation of tetra- and pentapeptides across the cellular membrane in an energy-dependent manner.	No verified direct reference in this release
`At4g27730`	Involved in the translocation of tetra- and pentapeptides across the cellular membrane in an energy-dependent manner.	AtOPT6 transports glutathione derivatives and is induced by primisulfuron.2004 · DOI: 10.1104/pp.104.039859
`At5g53520`	May be involved in the translocation of tetra- and pentapeptides across the cellular membrane in an energy-dependent manner.	No verified direct reference in this release
`At1g09930`	Involved in the translocation of tetra- and pentapeptides across the cellular membrane in an energy-dependent manner.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038238 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0015031 protein transport Biological Process

GO:0048235 pollen sperm cell differentiation Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0035673 oligopeptide transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G09930

ath:AT4G10770

ath:AT4G27730

ath:AT5G53510

ath:AT5G53520

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.388

Rank 1 · LXL04_038238 · OH-1004

Endoplasmic reticulum0.223

Rank 2 · LXL04_038238 · OH-1004

Cell membrane0.195

Rank 3 · LXL04_038238 · OH-1004

Golgi apparatus0.108

Rank 4 · LXL04_038238 · OH-1004

Cytoplasm0.091

Rank 5 · LXL04_038238 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03169.21OPT67-159 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038238	`PF03169.21`	OPT	67	159	4.8e-21	75.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82485`	Arabidopsis thaliana	Oligopeptide transporter 7	86.726%	Swiss-Prot	moderate database homology
`Q9FJD2`	Arabidopsis thaliana	Oligopeptide transporter 9	61.314%	Swiss-Prot	strong database homology
`Q9T095`	Arabidopsis thaliana	Oligopeptide transporter 6	65.041%	Swiss-Prot	strong database homology
`Q9FJD1`	Arabidopsis thaliana	Oligopeptide transporter 8	64.706%	Swiss-Prot	moderate database homology
`O04514`	Arabidopsis thaliana	Oligopeptide transporter 2	61.207%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card