LXL04_038059 | RubberDandelionOmics

Gene overview

LXL04_038059

Reference: OH-1004 Chr: Chr09 Coordinates: 30543272-30545113 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1842 bp · LXL04_038059|LXL04_038059|OH1004|cDNA

ATGGAAGAATCAACACCATTACCTTCACCAGCATCATCATGCGGAAGTTCAAGGCCTCAAGATTCTACCTTCGATCAAGATCTGGCAATCGATATGCAACTAAAGTGCATGATCAAATGCAATCTCCCTTTCAGCGATACCTTTACAAAATTCTCTCAAAAACTGCAACCACAATACAAAGGGGTTAGTACCACTTCTCTTCATGATCGTGCTGTTAAACATTACGTACGAGCTAAAAAAGATTTGATTATATATTTCGA...

CDS

Download CDS FASTA

1842 bp · LXL04_038059|LXL04_038059|OH1004|CDS

ATGGAAGAATCAACACCATTACCTTCACCAGCATCATCATGCGGAAGTTCAAGGCCTCAAGATTCTACCTTCGATCAAGATCTGGCAATCGATATGCAACTAAAGTGCATGATCAAATGCAATCTCCCTTTCAGCGATACCTTTACAAAATTCTCTCAAAAACTGCAACCACAATACAAAGGGGTTAGTACCACTTCTCTTCATGATCGTGCTGTTAAACATTACGTACGAGCTAAAAAAGATTTGATTATATATTTCGA...

Protein

Download Protein FASTA

613 aa · LXL04_038059|LXL04_038059|OH1004|PROTEIN

MEESTPLPSPASSCGSSRPQDSTFDQDLAIDMQLKCMIKCNLPFSDTFTKFSQKLQPQYKGVSTTSLHDRAVKHYVRAKKDLIIYFENYQSKVSLTVYQWKTTGGYYNVPYTCVTCHWIDRETWKISKRIISLEQYELDLDEVILESLSEFNLKGQVMSVSVDDSDGFYQPTMTKLKTEMNPMFEGVLFHTKCVSRILNSMVKSSLDHVAPVIKKFEGLFNFIFMSHENKFEKFVRAKGAKVPYMLRNLPYQWNTTYTML...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038059`
TK1151 ID	TkA04G385480
OH-1004 ID	LXL04_038059
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.100
Protein coverage (%)	TK1151 99.290 / OH-1004 92.007 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038059

Location Chr09:30543272-30545113 (+)

Description Similar to Os05g0583200: Zinc finger BED domain-containing protein RICESLEEPER 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g42170`	Transposase-like protein that is essential for plant growth and development.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0583200`	Transposase-like protein that is essential for plant growth and development.	No verified direct reference in this release
`Os03g0733400`	Transposase-like protein that is essential for plant growth and development.	No verified direct reference in this release
`Os05g0239150`	Transposase-like protein that is essential for plant growth and development.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038059 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006310 DNA recombination Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0032196 transposition Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0046983 protein dimerization activity Molecular Function

KEGG gene cross-reference

ath:AT3G42170

dosa:Os03g0733400

dosa:Os05g0239150

dosa:Os05g0583200

osa:4339741

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.908

Rank 1 · LXL04_038059 · OH-1004

Cytoplasm0.154

Rank 2 · LXL04_038059 · OH-1004

Mitochondrion0.025

Rank 3 · LXL04_038059 · OH-1004

Cell membrane0.018

Rank 4 · LXL04_038059 · OH-1004

Endoplasmic reticulum0.009

Rank 5 · LXL04_038059 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27041.1ZBED1_RNase-like107-180 aa

PF27039.1ZBED1_RNase-like_helical192-295 aa

PF05699.20Dimer_Tnp_hAT468-528 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038059	`PF27041.1`	ZBED1_RNase-like	107	180	4e-09	37.2
LXL04_038059	`PF27039.1`	ZBED1_RNase-like_helical	192	295	5.9e-12	46.3
LXL04_038059	`PF05699.20`	Dimer_Tnp_hAT	468	528	3.3e-10	40.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M2N5`	Arabidopsis thaliana	Zinc finger BED domain-containing protein DAYSLEEPER	24.022%	Swiss-Prot	weak database homology
`Q75HY5`	Oryza sativa subsp. japonica	Zinc finger BED domain-containing protein RICESLEEPER 3	23.774%	Swiss-Prot	weak database homology
`Q6AVI0`	Oryza sativa subsp. japonica	Zinc finger BED domain-containing protein RICESLEEPER 2	23.473%	Swiss-Prot	weak database homology
`B9FJG3`	Oryza sativa subsp. japonica	Zinc finger BED domain-containing protein RICESLEEPER 1	22.667%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card