LXL04_037130 | RubberDandelionOmics

Gene overview

LXL04_037130

Reference: OH-1004 Chr: Chr08 Coordinates: 53763456-53766408 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2127 bp · LXL04_037130|LXL04_037130|OH1004|cDNA

ATGGAAGAGACATTTGCGCCTTTTCAAGGTATCAAGAACGACATCGATGGGCGATTGACGTGTTACAAGCAAGATTGGACAGGCGGCTTCCGTGCAGGCTTCAGAATTTTGGCTCCCACCACATATATATTCTTCGCCTCCGCAATCCCAGTTATATCGTTTGGCGAACAACTGGACAGAAATACGGAAGGAGCTCTGACGGCGGTTCAAACATTGGCGTCCACGGCAATATGTGGGATCATACACTCGTTGATTGGAGG...

CDS

Download CDS FASTA

2127 bp · LXL04_037130|LXL04_037130|OH1004|CDS

ATGGAAGAGACATTTGCGCCTTTTCAAGGTATCAAGAACGACATCGATGGGCGATTGACGTGTTACAAGCAAGATTGGACAGGCGGCTTCCGTGCAGGCTTCAGAATTTTGGCTCCCACCACATATATATTCTTCGCCTCCGCAATCCCAGTTATATCGTTTGGCGAACAACTGGACAGAAATACGGAAGGAGCTCTGACGGCGGTTCAAACATTGGCGTCCACGGCAATATGTGGGATCATACACTCGTTGATTGGAGG...

Protein

Download Protein FASTA

708 aa · LXL04_037130|LXL04_037130|OH1004|PROTEIN

MEETFAPFQGIKNDIDGRLTCYKQDWTGGFRAGFRILAPTTYIFFASAIPVISFGEQLDRNTEGALTAVQTLASTAICGIIHSLIGGQPLLILGVAEPTVLMYTFMYNFAKQRPELGHNLFLAWSGWVCVWTAALLFLLAILGACSIINRFTRVAGELFGLLIAMLFMQQAIRGLVDEFRIPERANLKSVEFIPSWRFANGMFALVLAFGLLLTGLKSRKARSWRYGSGWIRSLIADYGVPLMVLVWTAVSYAPGASVPK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037130`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037130

Location Chr08:53763456-53766408 (+)

Description Similar to BOR1: Boron transporter 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g47160`	Efflux-type boron (B) transporter for xylem loading, responsive of boron translocation from roots to shoots under boron limitation.	Arabidopsis boron transporter for xylem loading.2002 · DOI: 10.1038/nature01139 Improvement of seed yields under boron-limiting conditions through overexpression of BOR1, a boron transporter for xylem loading, in Arabidopsis thaliana.2006 · DOI: 10.1111/j.1365-313x.2006.02763.x DRP1-Dependent Endocytosis is Essential for Polar Localization and Boron-Induced Degradation of the Borate Transporter BOR1 in Arabidopsis thaliana.2016 · DOI: 10.1093/pcp/pcw121 bor1-1, an Arabidopsis thaliana mutant that requires a high level of boron.1997 · DOI: 10.1104/pp.115.3.901
`At3g62270`	Probable boron transporter.	No verified direct reference in this release
`At3g06450`	Probable boron transporter.	No verified direct reference in this release
`At1g15460`	Efflux-type boron transporter polarly localized in roots.	Plants tolerant of high boron levels.2007 · DOI: 10.1126/science.1146634
`At1g74810`	Putative boron transporter.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037130 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006820 monoatomic anion transport Biological Process

GO:0010036 response to boron-containing substance Biological Process

GO:0035445 borate transmembrane transport Biological Process

GO:0046713 borate transport Biological Process

GO:0048364 root development Biological Process

GO:0050801 monoatomic ion homeostasis Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0080029 cellular response to boron-containing substance levels Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005768 endosome Cellular Component

GO:0005773 vacuole Cellular Component

KEGG gene cross-reference

ath:AT1G15460

ath:AT1G74810

ath:AT2G47160

ath:AT3G06450

ath:AT3G62270

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.497

Rank 1 · LXL04_037130 · OH-1004

Endoplasmic reticulum0.184

Rank 2 · LXL04_037130 · OH-1004

Cytoplasm0.143

Rank 3 · LXL04_037130 · OH-1004

Lysosome / Vacuole0.128

Rank 4 · LXL04_037130 · OH-1004

Golgi apparatus0.115

Rank 5 · LXL04_037130 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00955.28HCO3_cotransp7-180 aa

PF00955.28HCO3_cotransp201-372 aa

PF00955.28HCO3_cotransp473-615 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037130	`PF00955.28`	HCO3_cotransp	7	180	4.2e-92	310.4
LXL04_037130	`PF00955.28`	HCO3_cotransp	201	372	4.2e-92	310.4
LXL04_037130	`PF00955.28`	HCO3_cotransp	473	615	4.2e-92	310.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VYR7`	Arabidopsis thaliana	Boron transporter 1	78.561%	Swiss-Prot	strong database homology
`Q9M1P7`	Arabidopsis thaliana	Probable boron transporter 2	76.748%	Swiss-Prot	strong database homology
`Q93Z13`	Arabidopsis thaliana	Probable boron transporter 3	72.534%	Swiss-Prot	strong database homology
`Q9XI23`	Arabidopsis thaliana	Boron transporter 4	58.686%	Swiss-Prot	strong database homology
`Q9SSG5`	Arabidopsis thaliana	Putative boron transporter 5	57.831%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card