LXL04_036874 | RubberDandelionOmics

Gene overview

LXL04_036874

Reference: OH-1004 Chr: Chr08 Coordinates: 49635061-49635952 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

441 bp · LXL04_036874|LXL04_036874|OH1004|cDNA

ATGTCGTTCAGATTCAGAGGAGGGGCGAATGCTTCATCTGGAATGGGTGTCGCCGATCACTGCAAAGGCACCTTCTTGGAACTTCAAAGAAAGAAGGCTCACCGTTATGTGATCTTCAAGATCGACGACAAGAAAAACGAAGTTATTGTCGAGAAAACCGGAAATCCAGCTGAAAGCTACGAAGATTTCACATTAGCGTTACCGGAGAATGATTGCAGATACGCCATATACGACTACGATTTTGTCACCTCCGACAATTG...

CDS

Download CDS FASTA

441 bp · LXL04_036874|LXL04_036874|OH1004|CDS

ATGTCGTTCAGATTCAGAGGAGGGGCGAATGCTTCATCTGGAATGGGTGTCGCCGATCACTGCAAAGGCACCTTCTTGGAACTTCAAAGAAAGAAGGCTCACCGTTATGTGATCTTCAAGATCGACGACAAGAAAAACGAAGTTATTGTCGAGAAAACCGGAAATCCAGCTGAAAGCTACGAAGATTTCACATTAGCGTTACCGGAGAATGATTGCAGATACGCCATATACGACTACGATTTTGTCACCTCCGACAATTG...

Protein

Download Protein FASTA

146 aa · LXL04_036874|LXL04_036874|OH1004|PROTEIN

MSFRFRGGANASSGMGVADHCKGTFLELQRKKAHRYVIFKIDDKKNEVIVEKTGNPAESYEDFTLALPENDCRYAIYDYDFVTSDNCQKSKIFFIAWSPATSRIRAKMLYATSKDRLRHELDGVHYEIQATDPTEMELDVLKERVY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036874`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036874

Location Chr08:49635061-49635952 (+)

Description Similar to ADF6: Actin-depolymerizing factor 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g31200`	Actin-depolymerizing protein.	Molecular identification and characterization of the Arabidopsis AtADF1, AtADFS and AtADF6 genes.2001 · DOI: 10.1023/a:1010687911374
`At1g01750`	Actin-depolymerizing protein.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0628100`	Actin-depolymerizing protein.	No verified direct reference in this release
`Os03g0780400`	Actin-depolymerizing protein.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036874 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0030042 actin filament depolymerization Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0015629 actin cytoskeleton Cellular Component

GO:0003779 actin binding Molecular Function

GO:0051015 actin filament binding Molecular Function

KEGG gene cross-reference

ath:AT1G01750

ath:AT2G31200

dosa:Os03g0780400

dosa:Os12g0628100

vvi:100232871

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.793

Rank 1 · LXL04_036874 · OH-1004

Nucleus0.268

Rank 2 · LXL04_036874 · OH-1004

Cell membrane0.094

Rank 3 · LXL04_036874 · OH-1004

Mitochondrion0.045

Rank 4 · LXL04_036874 · OH-1004

Golgi apparatus0.044

Rank 5 · LXL04_036874 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00241.26Cofilin_ADF14-145 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036874	`PF00241.26`	Cofilin_ADF	14	145	5.3e-41	140.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZSK2`	Arabidopsis thaliana	Actin-depolymerizing factor 6	73.611%	Swiss-Prot	strong database homology
`Q9LQ81`	Arabidopsis thaliana	Actin-depolymerizing factor 10	63.504%	Swiss-Prot	strong database homology
`Q2QLT8`	Oryza sativa subsp. japonica	Actin-depolymerizing factor 11	72.603%	Swiss-Prot	strong database homology
`Q9AY76`	Oryza sativa subsp. japonica	Actin-depolymerizing factor 2	70.548%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card