LXL04_036150 | RubberDandelionOmics

Gene overview

LXL04_036150

Reference: OH-1004 Chr: Chr08 Coordinates: 36686969-36688804 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1347 bp · LXL04_036150|LXL04_036150|OH1004|cDNA

atgcGTGAGATTCTTCACATCCAAGGAGGCCAATGCGGCAACCAGATCGGTGCCAAGTTCTGGGAGGTGGTTTGTGCTGAACACGGCATTGATTCTACTGGCCGTTACCAAGGCGATACAGATCTGCAACTAGAGAGGATCAATGTTTATTACAATGAAGCTAGTTGTGGCAGATTCGTTCCTAGGGCCGTACTTATGGATCTCGAGCCCGGTACCATGGATAGTCTCAGATCTGGTCCTTATGGACAAATCTTCCGACC...

CDS

Download CDS FASTA

1347 bp · LXL04_036150|LXL04_036150|OH1004|CDS

ATGCGTGAGATTCTTCACATCCAAGGAGGCCAATGCGGCAACCAGATCGGTGCCAAGTTCTGGGAGGTGGTTTGTGCTGAACACGGCATTGATTCTACTGGCCGTTACCAAGGCGATACAGATCTGCAACTAGAGAGGATCAATGTTTATTACAATGAAGCTAGTTGTGGCAGATTCGTTCCTAGGGCCGTACTTATGGATCTCGAGCCCGGTACCATGGATAGTCTCAGATCTGGTCCTTATGGACAAATCTTCCGACC...

Protein

Download Protein FASTA

448 aa · LXL04_036150|LXL04_036150|OH1004|PROTEIN

MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGDTDLQLERINVYYNEASCGRFVPRAVLMDLEPGTMDSLRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRTMLTFSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLNHLISATMSGVTCCLRFPGQLNSDLRKLAVNLVPF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036150`
TK1151 ID	TkA04G071300
OH-1004 ID	LXL04_036150
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 96.063 / OH-1004 81.696 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036150

Location Chr08:36686969-36688804 (+)

Description Similar to TUBB1: Tubulin beta-1 chain

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0105600`	Tubulin is the major constituent of microtubules, a cylinder consisting of laterally associated linear protofilaments composed of alpha- and beta-tubulin heterodimers.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036150 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000226 microtubule cytoskeleton organization Biological Process

GO:0000278 mitotic cell cycle Biological Process

GO:0007017 microtubule-based process Biological Process

GO:0090378 seed trichome elongation Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005874 microtubule Cellular Component

GO:0003924 GTPase activity Molecular Function

GO:0005200 structural constituent of cytoskeleton Molecular Function

GO:0005525 GTP binding Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ghi:107926975

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.758

Rank 1 · LXL04_036150 · OH-1004

Mitochondrion0.151

Rank 2 · LXL04_036150 · OH-1004

Nucleus0.101

Rank 3 · LXL04_036150 · OH-1004

Cell membrane0.046

Rank 4 · LXL04_036150 · OH-1004

Golgi apparatus0.029

Rank 5 · LXL04_036150 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00091.32Tubulin3-211 aa

PF03953.23Tubulin_C261-382 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036150	`PF00091.32`	Tubulin	3	211	1.7e-64	218.3
LXL04_036150	`PF03953.23`	Tubulin_C	261	382	1.4e-40	139.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H7U1`	Oryza sativa subsp. japonica	Tubulin beta-2 chain	95.973%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card