Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1593 bp · LXL04_035491|LXL04_035491|OH1004|cDNA
ATGTCTCTCGATCTCTCTCAACTCCACCCATGGCTTCCGCTTCTGTTTTATTCACCTCCACCTTCTCAGGCTAAAGAGATAGCGGGTGTGTATACTCCAGCTCTTCTCAGGGGGCCGAAGAGCAACTTTTTCGAAATACAACAAAAGGGAAACGAAGAAGCTTCGAGGGCTTACCCGTCGATTACCAAGGTGATTACTAAGAAGTTCGATATGAGCACTGAAGTTGGGTGGTACATACTTTCCGAAGATCAACAACACGT...
1593 bp · LXL04_035491|LXL04_035491|OH1004|CDS
ATGTCTCTCGATCTCTCTCAACTCCACCCATGGCTTCCGCTTCTGTTTTATTCACCTCCACCTTCTCAGGCTAAAGAGATAGCGGGTGTGTATACTCCAGCTCTTCTCAGGGGGCCGAAGAGCAACTTTTTCGAAATACAACAAAAGGGAAACGAAGAAGCTTCGAGGGCTTACCCGTCGATTACCAAGGTGATTACTAAGAAGTTCGATATGAGCACTGAAGTTGGGTGGTACATACTTTCCGAAGATCAACAACACGT...
Protein
Download Protein FASTA530 aa · LXL04_035491|LXL04_035491|OH1004|PROTEIN
MSLDLSQLHPWLPLLFYSPPPSQAKEIAGVYTPALLRGPKSNFFEIQQKGNEEASRAYPSITKVITKKFDMSTEVGWYILSEDQQHVGPYAASELREHFSSGYITGDTLVWAEGRSEWQPLSSVPGLISDTPEQEPSLAAIDDEFERWQNEVKSAEAEADDMRPSSPPDGQEEFTDDDGTVYKWDKKLRAWVPQDEPIAGSEPYDVDHMTFQQEEELFPTIAADGVPVKEDTNTSIIPNADVIAEKETDDANEPTEANGK...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_035491 |
|---|---|
| TK1151 ID | TkA04G127200 |
| OH-1004 ID | LXL04_035491 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 86.792Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_035491 |
|---|---|
| Location | Chr08:23534865-23537822 (-) |
| Description | Similar to Htatsf1: HIV Tat-specific factor 1 homolog |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000398 mRNA splicing, via spliceosome Biological Process GO:0000724 double-strand break repair via homologous recombination Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0034337 RNA folding Biological Process GO:0045292 mRNA cis splicing, via spliceosome Biological Process GO:1903241 U2-type prespliceosome assembly Biological Process GO:1990166 protein localization to site of double-strand break Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005684 U2-type spliceosomal complex Cellular Component GO:0005686 U2 snRNP Cellular Component GO:0035861 site of double-strand break Cellular Component |
| KEGG gene cross-reference | hsa:27336 mmu:72459 pon:100172491 sce:YNL286W spo:2539783 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF14237.12GYF_277-127 aaPF00076.29RRM_1289-359 aaPF00076.29RRM_1445-497 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_035491 | PF14237.12 | GYF_2 | 77 | 127 | 1.3e-17 | 64.0 |
| LXL04_035491 | PF00076.29 | RRM_1 | 289 | 359 | 3.5e-17 | 62.7 |
| LXL04_035491 | PF00076.29 | RRM_1 | 445 | 497 | 3.5e-17 | 62.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.