LXL04_034826 | RubberDandelionOmics

Gene overview

LXL04_034826

Reference: OH-1004 Chr: Chr08 Coordinates: 3593042-3597026 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2370 bp · LXL04_034826|LXL04_034826|OH1004|cDNA

ATGCTCAACGCCGCCACCACCTCCGCCTCTGTATCATCGATTCCGGCTTCCGTATTCTGCTGCGCAACTCAATACACCTCAAGGAGAAGGATCAAACGCTCCCAAAACAACTGCCGTGCTGTTGCTGGGAACTTTGGGCATTTCGTACAGGTTGTAAAGAAGGATGTAGATTTTCTCAAGAAGAATATCAGTGCAGGCATCAATTGGACGAGTGAAGCTCTTGGTTTTCCAGAGATTTCGAAAAAGGTAGATGAATATGT...

CDS

Download CDS FASTA

2370 bp · LXL04_034826|LXL04_034826|OH1004|CDS

ATGCTCAACGCCGCCACCACCTCCGCCTCTGTATCATCGATTCCGGCTTCCGTATTCTGCTGCGCAACTCAATACACCTCAAGGAGAAGGATCAAACGCTCCCAAAACAACTGCCGTGCTGTTGCTGGGAACTTTGGGCATTTCGTACAGGTTGTAAAGAAGGATGTAGATTTTCTCAAGAAGAATATCAGTGCAGGCATCAATTGGACGAGTGAAGCTCTTGGTTTTCCAGAGATTTCGAAAAAGGTAGATGAATATGT...

Protein

Download Protein FASTA

789 aa · LXL04_034826|LXL04_034826|OH1004|PROTEIN

MLNAATTSASVSSIPASVFCCATQYTSRRRIKRSQNNCRAVAGNFGHFVQVVKKDVDFLKKNISAGINWTSEALGFPEISKKVDEYVWLRNLEDPHYSGEFQSPSWPQPYYPELSGTDLMMADLKALETYIMYYYQLSKMWTKPLPEVYNAQEADDYFKCRPHIVALRLIEVFGSFASAAIRIRLQGITKSDEYNSQYQFGMVLKETMLDLGPTFIKVGQSLSTRPDIIGFEISKALSELHDQIPPFPRSLAMQIIEEEL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_034826`
TK1151 ID	TkA04G201920
OH-1004 ID	LXL04_034826
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	92.800
Protein coverage (%)	TK1151 97.275 / OH-1004 94.804 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_034826

Location Chr08:3593042-3597026 (+)

Description Similar to slr1919: Uncharacterized protein slr1919 (Synechocystis sp. (strain PCC 6803 / Kazusa)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g79600`	Kinase that can phosphorylate the tocopherol cyclase VTE1, a key enzyme of tocopherol (vitamin E) metabolism and involved in the recycling of oxidated alpha-tocopherol quinone, possibly stabilizing it at plastoglobules.	A chloroplast ABC1-like kinase regulates vitamin E metabolism in Arabidopsis.2013 · DOI: 10.1104/pp.113.218644 Loss of plastoglobule kinases ABC1K1 and ABC1K3 causes conditional degreening, modified prenyl-lipids, and recruitment of the jasmonic acid pathway.2013 · DOI: 10.1105/tpc.113.111120
`At4g31390`	Kinase that can phosphorylate the tocopherol cyclase VTE1, a key enzyme of tocopherol (vitamin E) metabolism and involved in the recycling of oxidated alpha-tocopherol quinone, possibly stabilizing it at plastoglobules.	AtACDO1, an ABC1-like kinase gene, is involved in chlorophyll degradation and the response to photooxidative stress in Arabidopsis.2012 · DOI: 10.1093/jxb/ers072 Loss of plastoglobule kinases ABC1K1 and ABC1K3 causes conditional degreening, modified prenyl-lipids, and recruitment of the jasmonic acid pathway.2013 · DOI: 10.1105/tpc.113.111120 ABC1K1/PGR6 kinase: a regulatory link between photosynthetic activity and chloroplast metabolism.2014 · DOI: 10.1111/tpj.12385
`At1g71810`	Uncharacterized aarF domain-containing protein kinase At1g71810, chloroplastic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034826 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006995 cellular response to nitrogen starvation Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009637 response to blue light Biological Process

GO:0009644 response to high light intensity Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009767 photosynthetic electron transport chain Biological Process

GO:0010027 thylakoid membrane organization Biological Process

GO:0010109 regulation of photosynthesis Biological Process

GO:0010114 response to red light Biological Process

GO:0015996 chlorophyll catabolic process Biological Process

GO:0031540 regulation of anthocyanin biosynthetic process Biological Process

GO:0050821 protein stabilization Biological Process

KEGG gene cross-reference

ath:AT1G71810

ath:AT1G79600

ath:AT4G31390

syn:sll0005

syn:slr1919

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.973

Rank 1 · LXL04_034826 · OH-1004

Mitochondrion0.035

Rank 2 · LXL04_034826 · OH-1004

Cytoplasm0.018

Rank 3 · LXL04_034826 · OH-1004

Cell membrane0.016

Rank 4 · LXL04_034826 · OH-1004

Nucleus0.014

Rank 5 · LXL04_034826 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03109.23ABC1240-499 aa

PF01636.30APH436-473 aa

PF27536.1UbiB_helical536-582 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_034826	`PF03109.23`	ABC1	240	499	8.1e-71	238.8
LXL04_034826	`PF01636.30`	APH	436	473	4.2e-07	30.7
LXL04_034826	`PF27536.1`	UbiB_helical	536	582	3.7e-06	27.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9MA15`	Arabidopsis thaliana	Protein ACTIVITY OF BC1 COMPLEX KINASE 3, chloroplastic	33.984%	Swiss-Prot	moderate database homology
`Q8RWG1`	Arabidopsis thaliana	Protein ACTIVITY OF BC1 COMPLEX KINASE 1, chloroplastic	34.426%	Swiss-Prot	moderate database homology
`Q94BU1`	Arabidopsis thaliana	Uncharacterized aarF domain-containing protein kinase At1g71810, chloroplastic	30.366%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card