LXL04_034779 | RubberDandelionOmics

Gene overview

LXL04_034779

Reference: OH-1004 Chr: Chr07 Coordinates: 116510176-116515420 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3441 bp · LXL04_034779|LXL04_034779|OH1004|cDNA

ATGAAGCTGTTAGTACGTGTGATCGAAGCCAAGAATCTCCCTGCAATGGATCCAAATGGTTTCATGGATCCATATGTCAAATTAAAACTAGGGAACCAGAGGTTCAAGACTAAAGTGGTAAAAAAGTGCTTAAACCCTTCTTGGTGCGACGAATTTAGTTTCAAGGTCGAAGATTTGAAGGAGCAACTTGTTGTTACACTGTTGAATGAAGACAAGTACTTCAATGACGATTTTGTTGGGAGCATTAAAATCCCCATTTC...

CDS

Download CDS FASTA

3441 bp · LXL04_034779|LXL04_034779|OH1004|CDS

ATGAAGCTGTTAGTACGTGTGATCGAAGCCAAGAATCTCCCTGCAATGGATCCAAATGGTTTCATGGATCCATATGTCAAATTAAAACTAGGGAACCAGAGGTTCAAGACTAAAGTGGTAAAAAAGTGCTTAAACCCTTCTTGGTGCGACGAATTTAGTTTCAAGGTCGAAGATTTGAAGGAGCAACTTGTTGTTACACTGTTGAATGAAGACAAGTACTTCAATGACGATTTTGTTGGGAGCATTAAAATCCCCATTTC...

Protein

Download Protein FASTA

1146 aa · LXL04_034779|LXL04_034779|OH1004|PROTEIN

MKLLVRVIEAKNLPAMDPNGFMDPYVKLKLGNQRFKTKVVKKCLNPSWCDEFSFKVEDLKEQLVVTLLNEDKYFNDDFVGSIKIPISQVFDTLDKSLGTVWYPLQPKKKSKFKECGEILLTVCFSQNNSPSELQPQVENGTMSPARSSTSSRMSSSPMRSEEAAAPLKEEKTNKEKISSLLSQIFNRNNESVLPPPSVTSTKLPEVPETDDSEVPEEKTEEETSAASFEQLMKSMEEKDEGREMPDNLPGGVMLDQMYVM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_034779`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_034779

Location Chr07:116510176-116515420 (+)

Description Similar to At1g03370: C2 and GRAM domain-containing protein At1g03370

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g03370`	C2 and GRAM domain-containing protein At1g03370.	No verified direct reference in this release
`At5g50170`	C2 and GRAM domain-containing protein At5g50170.	No verified direct reference in this release
`At3g59660`	Involved in proteolytic processing of BAG6.	Aspartyl Protease-Mediated Cleavage of BAG6 Is Necessary for Autophagy and Fungal Resistance in Plants.2016 · DOI: 10.1105/tpc.15.00626
`At1g22610`	Regulates flowering time under long days.	Characterization of Multiple C2 Domain and Transmembrane Region Proteins in Arabidopsis.2018 · DOI: 10.1104/pp.17.01144

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0370600`	Promotes nuclear translocation of the transcription factor OSH1, which directly suppresses the auxin biosynthetic gene YUCCA4 during the late development of anthers.	OsFTIP7 determines auxin-mediated anther dehiscence in rice.2018 · DOI: 10.1038/s41477-018-0175-0

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034779 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009663 plasmodesma organization Biological Process

GO:0009911 positive regulation of flower development Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0048574 long-day photoperiodism, flowering Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009511 plasmodesmatal endoplasmic reticulum Cellular Component

KEGG gene cross-reference

ath:AT1G03370

ath:AT1G22610

ath:AT3G59660

ath:AT5G50170

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.291

Rank 1 · LXL04_034779 · OH-1004

Endoplasmic reticulum0.269

Rank 2 · LXL04_034779 · OH-1004

Golgi apparatus0.244

Rank 3 · LXL04_034779 · OH-1004

Cytoplasm0.210

Rank 4 · LXL04_034779 · OH-1004

Nucleus0.118

Rank 5 · LXL04_034779 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00168.37C22-104 aa

PF16016.12VASt253-401 aa

PF00168.37C2538-639 aa

PF02893.27GRAM691-770 aa

PF16016.12VASt877-1015 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_034779	`PF00168.37`	C2	2	104	4.8e-46	156.0
LXL04_034779	`PF16016.12`	VASt	253	401	6.5e-58	196.1
LXL04_034779	`PF00168.37`	C2	538	639	4.8e-46	156.0
LXL04_034779	`PF02893.27`	GRAM	691	770	1e-18	67.9
LXL04_034779	`PF16016.12`	VASt	877	1015	6.5e-58	196.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZVT9`	Arabidopsis thaliana	C2 and GRAM domain-containing protein At1g03370	61.751%	Swiss-Prot	strong database homology
`Q9FGS8`	Arabidopsis thaliana	C2 and GRAM domain-containing protein At5g50170	43.396%	Swiss-Prot	moderate database homology
`Q8W4D4`	Arabidopsis thaliana	BAG-associated GRAM protein 1	24.426%	Swiss-Prot	weak database homology
`Q9SKA3`	Arabidopsis thaliana	Multiple C2 domain and transmembrane region protein 6	41.463%	Swiss-Prot	weak database homology
`Q60EW9`	Oryza sativa subsp. japonica	FT-interacting protein 7	35.246%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card