LXL04_033892 | RubberDandelionOmics

Gene overview

LXL04_033892

Reference: OH-1004 Chr: Chr07 Coordinates: 63607614-63608216 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

297 bp · LXL04_033892|LXL04_033892|OH1004|cDNA

ATGAAACCAATGATTTTTGGGAGCAAATTAAAACACCTGGCACACGTCCCCCATCTTTTGACTGAAGGAGATGGTACAAAAAGTGCCACCATAATTGGTAATGTTTATATTCACCCCTCAGCTAAAGTTCATCCCACTGCAAAGATTGGTCCAAACGTTTCCATATCTGTCGATGCAGATATTGGAGCCGGTGTACGGTTAATCAACTTTATTATTCTTGATGATGTTAAAATCAATGAAAATGTTGTCATTCATTCAAT...

CDS

Download CDS FASTA

297 bp · LXL04_033892|LXL04_033892|OH1004|CDS

ATGAAACCAATGATTTTTGGGAGCAAATTAAAACACCTGGCACACGTCCCCCATCTTTTGACTGAAGGAGATGGTACAAAAAGTGCCACCATAATTGGTAATGTTTATATTCACCCCTCAGCTAAAGTTCATCCCACTGCAAAGATTGGTCCAAACGTTTCCATATCTGTCGATGCAGATATTGGAGCCGGTGTACGGTTAATCAACTTTATTATTCTTGATGATGTTAAAATCAATGAAAATGTTGTCATTCATTCAAT...

Protein

Download Protein FASTA

98 aa · LXL04_033892|LXL04_033892|OH1004|PROTEIN

MKPMIFGSKLKHLAHVPHLLTEGDGTKSATIIGNVYIHPSAKVHPTAKIGPNVSISVDADIGAGVRLINFIILDDVKINENVVIHSIVGWKCSIGRWS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033892`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_033892`
Location	Chr07:63607614-63608216 (+)
Description	Similar to gmppaa: Mannose-1-phosphate guanyltransferase alpha-A
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_033892` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0009100 glycoprotein metabolic process Biological Process GO:0009101 glycoprotein biosynthetic process Biological Process GO:0009298 GDP-mannose biosynthetic process Biological Process GO:0019673 GDP-mannose metabolic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0070062 extracellular exosome Cellular Component GO:0120508 GDP-mannose pyrophosphorylase complex Cellular Component GO:0004857 enzyme inhibitor activity Molecular Function GO:0005525 GTP binding Molecular Function GO:0016740 transferase activity Molecular Function GO:0016779 nucleotidyltransferase activity Molecular Function
KEGG gene cross-reference	hsa:29926 mmu:69080 panu:100137607 rno:501167 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.474

Rank 1 · LXL04_033892 · OH-1004

Nucleus0.226

Rank 2 · LXL04_033892 · OH-1004

Mitochondrion0.123

Rank 3 · LXL04_033892 · OH-1004

Plastid0.074

Rank 4 · LXL04_033892 · OH-1004

Extracellular0.067

Rank 5 · LXL04_033892 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00132.31Hexapep30-55 aa

PF25087.2GMPPB_C31-98 aa

PF25084.2LbH_EIF2B33-87 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033892	`PF00132.31`	Hexapep	30	55	8.5e-07	29.1
LXL04_033892	`PF25087.2`	GMPPB_C	31	98	3e-22	79.2
LXL04_033892	`PF25084.2`	LbH_EIF2B	33	87	3.8e-06	27.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card