LXL04_033724 | RubberDandelionOmics

Gene overview

LXL04_033724

Reference: OH-1004 Chr: Chr07 Coordinates: 54515226-54517011 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1115 bp · LXL04_033724|LXL04_033724|OH1004|cDNA

taataaataaaatcattacaaagaattataacCAGTTTATTTTACAACAGTTTAACTTAATTGACTCTAAATTACGTAGtgttcatttttatgtcatattttaatttccaTGCGCAACGCGCGGGAATTCGCCTCGTTTCATATATATAAGAAGCAAAATGTACAAGTTAGTTCGATGCCCATGTTGCTGGAAATTTCAGCAGGATCTACCTAAAGTTCCAGTCTATGTATGTGGAGGCTGTAATGCAATTCTTATAGTG...

CDS

Download CDS FASTA

957 bp · LXL04_033724|LXL04_033724|OH1004|CDS

ATGTACAAGTTAGTTCGATGCCCATGTTGCTGGAAATTTCAGCAGGATCTACCTAAAGTTCCAGTCTATGTATGTGGAGGCTGTAATGCAATTCTTATAGTGAAGGAGGATAAAAACGGTAGAGTTGTTCCAGAGCATGATAGAGAGATATTGGTAGCACACATGGATTTTGCTAAAAAGGCAGAAATTTATGGTAATAATATGTTTCCACATGCACCGAAAGTTCAAATCACTGAAGAAACAGAAAGATGCTACAGCCG...

Protein

Download Protein FASTA

318 aa · LXL04_033724|LXL04_033724|OH1004|PROTEIN

MYKLVRCPCCWKFQQDLPKVPVYVCGGCNAILIVKEDKNGRVVPEHDREILVAHMDFAKKAEIYGNNMFPHAPKVQITEETERCYSRYRGKCRKFLMLQEIHLMIAYVDAILPNSLKIPLQAIKDCTHDFNERNYLGKGGYGRVYKGILMWADNVNQLVAVKRLDVKGGQGNKEFHTELTMRSQYQHENIIALIGFCVENKEMIIVYEYASHGSLDTYLCGTAMSIELTWPQLLKICIDVASALDCLHNHVAEKHRIIHR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033724`
TK1151 ID	TkA08G304570
OH-1004 ID	LXL04_033724
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 31.933 / OH-1004 11.950 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033724

Location Chr07:54515226-54517011 (+)

Description Similar to HERK1: Receptor-like protein kinase HERK 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g46290`	Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.	Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106
`At5g59700`	Probable receptor-like protein kinase At5g59700.	No verified direct reference in this release
`At5g38990`	Probable receptor-like protein kinase At5g38990.	No verified direct reference in this release
`At5g39000`	Putative receptor-like protein kinase At5g39000.	No verified direct reference in this release
`At2g39360`	Probable receptor-like protein kinase At2g39360.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033724 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009741 response to brassinosteroid Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0010038 response to metal ion Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010483 pollen tube reception Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009536 plastid Cellular Component

GO:0043680 filiform apparatus Cellular Component

GO:0099503 secretory vesicle Cellular Component

KEGG gene cross-reference

ath:AT2G39360

ath:AT3G46290

ath:AT5G38990

ath:AT5G39000

ath:AT5G59700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.473

Rank 1 · LXL04_033724 · OH-1004

Nucleus0.298

Rank 2 · LXL04_033724 · OH-1004

Cell membrane0.199

Rank 3 · LXL04_033724 · OH-1004

Endoplasmic reticulum0.091

Rank 4 · LXL04_033724 · OH-1004

Mitochondrion0.088

Rank 5 · LXL04_033724 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22910.2EDR4-like_1st3-32 aa

PF00069.32Pkinase131-297 aa

PF07714.24PK_Tyr_Ser-Thr134-286 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033724	`PF22910.2`	EDR4-like_1st	3	32	6.9e-11	42.2
LXL04_033724	`PF00069.32`	Pkinase	131	297	7.3e-31	108.2
LXL04_033724	`PF07714.24`	PK_Tyr_Ser-Thr	134	286	1.3e-34	120.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LX66`	Arabidopsis thaliana	Receptor-like protein kinase HERK 1	49.412%	Swiss-Prot	moderate database homology
`Q9FN92`	Arabidopsis thaliana	Probable receptor-like protein kinase At5g59700	49.711%	Swiss-Prot	moderate database homology
`Q9FID9`	Arabidopsis thaliana	Probable receptor-like protein kinase At5g38990	46.154%	Swiss-Prot	moderate database homology
`Q9FID8`	Arabidopsis thaliana	Putative receptor-like protein kinase At5g39000	45.128%	Swiss-Prot	moderate database homology
`O80623`	Arabidopsis thaliana	Probable receptor-like protein kinase At2g39360	48.235%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card