Gene Card
Gene overview
cDNA / CDS / Protein Sequences
534 bp · LXL04_033656|LXL04_033656|OH1004|cDNA
ATGGCCTCGGGTGCTAGGGTTTTCAACGGTTGCAGAACACTATTTGCTGCAGCAAAGTCCGCCACTCCCAAATCCACGGCCACCGCTGCAACTACCACCACTGCTGCAAAGAAGACTGCCGTCAAAAAACCAACAGAGAAACCAGCGAAGAAACCGAAGCAAGCTTCCGCTGAGAAATCGTTGAAACCTGTTGGCATTCTGAAACCAACTCCGATTTCACCAGCCCTAGGTCACTTCCTCGGAGTCTCCGAGTCCGCTCG...
534 bp · LXL04_033656|LXL04_033656|OH1004|CDS
ATGGCCTCGGGTGCTAGGGTTTTCAACGGTTGCAGAACACTATTTGCTGCAGCAAAGTCCGCCACTCCCAAATCCACGGCCACCGCTGCAACTACCACCACTGCTGCAAAGAAGACTGCCGTCAAAAAACCAACAGAGAAACCAGCGAAGAAACCGAAGCAAGCTTCCGCTGAGAAATCGTTGAAACCTGTTGGCATTCTGAAACCAACTCCGATTTCACCAGCCCTAGGTCACTTCCTCGGAGTCTCCGAGTCCGCTCG...
Protein
Download Protein FASTA177 aa · LXL04_033656|LXL04_033656|OH1004|PROTEIN
MASGARVFNGCRTLFAAAKSATPKSTATAATTTTAAKKTAVKKPTEKPAKKPKQASAEKSLKPVGILKPTPISPALGHFLGVSESARTEAVKKIWQYIKLHELQANCDHEENEENAPKNCQVLYKLQPDYAMDDFVNPTNKREIICDEKLKTIFEGRDRVGFLEIAKLLAPHFVKTT
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_033656 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_033656 |
|---|---|
| Location | Chr07:51801380-51802307 (-) |
| Description | Similar to spp27: Upstream activation factor subunit spp27 (Schizosaccharomyces pombe (strain 972 / ATCC 24843) |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006361 transcription initiation at RNA polymerase I promoter Biological Process GO:0042790 nucleolar large rRNA transcription by RNA polymerase I Biological Process GO:0000500 RNA polymerase I upstream activating factor complex Cellular Component GO:0005634 nucleus Cellular Component GO:0005829 cytosol Cellular Component GO:0001165 RNA polymerase I cis-regulatory region sequence-specific DNA binding Molecular Function GO:0001181 RNA polymerase I general transcription initiation factor activity Molecular Function |
| KEGG gene cross-reference | spo:2539310 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF02201.24SWIB68-108 aaPF02201.24SWIB136-173 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_033656 | PF02201.24 | SWIB | 68 | 108 | 3.2e-26 | 91.6 |
| LXL04_033656 | PF02201.24 | SWIB | 136 | 173 | 3.2e-26 | 91.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.