RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_033652
Reference: OH-1004 Chr: Chr07 Coordinates: 51660320-51663649 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3330 bp · LXL04_033652|LXL04_033652|OH1004|cDNA

ATGGTGGTCAACGTACTACATCTCTACCTCTATACATGCATAGTCCTCACCTCTATCATATCCGTGTTGGGTTCCACTTTGCGTCCACCTTCCACGGCTAAACCAGACCCCTACAGATCATCATCCGCCATTAAAACGGATTCTGAAGCTCTGATTGAGTTCAAGAACATGATAGATGACCCTGATGACGTCCTCTCCAGCTGGAAGCTCACCAAGACGCCATGCAATTGGCATGGTGTGACATGCAGCGAGGGCCGAGT...

CDS

Download CDS FASTA

3330 bp · LXL04_033652|LXL04_033652|OH1004|CDS

ATGGTGGTCAACGTACTACATCTCTACCTCTATACATGCATAGTCCTCACCTCTATCATATCCGTGTTGGGTTCCACTTTGCGTCCACCTTCCACGGCTAAACCAGACCCCTACAGATCATCATCCGCCATTAAAACGGATTCTGAAGCTCTGATTGAGTTCAAGAACATGATAGATGACCCTGATGACGTCCTCTCCAGCTGGAAGCTCACCAAGACGCCATGCAATTGGCATGGTGTGACATGCAGCGAGGGCCGAGT...

Protein

Download Protein FASTA

1109 aa · LXL04_033652|LXL04_033652|OH1004|PROTEIN

MVVNVLHLYLYTCIVLTSIISVLGSTLRPPSTAKPDPYRSSSAIKTDSEALIEFKNMIDDPDDVLSSWKLTKTPCNWHGVTCSEGRVTQLDLNDSDLEGSVSFSSFSSLDMLTLLNLSENKRLFINSTSLCQLPFGLEQIILSNSGVTGSIPDKFLVNFKNLAVINLSRNSLTGFFPETLVSNPDLVQVLDLSSNSIYGSIPVTISSYTNLKNLNLSYNMITGKIPKSVGKLKNLQVLGFSHNLLTGWIPPELGNLCESL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_033652
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_033652
LocationChr07:51660320-51663649 (-)
DescriptionSimilar to BRL2: Serine/threonine-protein kinase BRI1-like 2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g01950 Receptor with a serine/threonine-protein kinase activity, which may transduce extracellular spatial and temporal signals into downstream cell differentiation responses in provascular and procambial cells.
VH1/BRL2 receptor-like kinase interacts with vascular-specific adaptor proteins VIT and VIK to influence leaf venation.2009 · DOI: 10.1111/j.1365-313x.2008.03742.x
At3g13380 Receptor with a dual specificity kinase activity acting on both serine/threonine- and tyrosine-containing substrates.
BRL1 and BRL3 are novel brassinosteroid receptors that function in vascular differentiation in Arabidopsis.2004 · DOI: 10.1242/dev.01403
At1g55610 Receptor with a serine/threonine-protein kinase activity.
BRL1, a leucine-rich repeat receptor-like protein kinase, is functionally redundant with BRI1 in regulating Arabidopsis brassinosteroid signaling.2004 · DOI: 10.1111/j.1365-313x.2004.02214.x
BRL1 and BRL3 are novel brassinosteroid receptors that function in vascular differentiation in Arabidopsis.2004 · DOI: 10.1242/dev.01403

Rice

Reference gene IDPossible functionPapers / DOI
Os10g0114400 May be involved in brassenosteroid (BR) perception. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_033652 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0009414 response to water deprivation Biological Process
GO:0009416 response to light stimulus Biological Process
GO:0009729 detection of brassinosteroid stimulus Biological Process
GO:0009734 auxin-activated signaling pathway Biological Process
GO:0009742 brassinosteroid mediated signaling pathway Biological Process
GO:0009755 hormone-mediated signaling pathway Biological Process
GO:0009791 post-embryonic development Biological Process
GO:0010051 xylem and phloem pattern formation Biological Process
GO:0010233 phloem transport Biological Process
GO:0010305 leaf vascular tissue pattern formation Biological Process
GO:0050832 defense response to fungus Biological Process
GO:0005886 plasma membrane Cellular Component
KEGG gene cross-reference
ath:AT1G55610
ath:AT2G01950
ath:AT3G13380
dosa:Os10g0114400
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.870
Rank 1 · LXL04_033652 · OH-1004
Endoplasmic reticulum0.084
Rank 2 · LXL04_033652 · OH-1004
Cytoplasm0.067
Rank 3 · LXL04_033652 · OH-1004
Nucleus0.047
Rank 4 · LXL04_033652 · OH-1004
Lysosome / Vacuole0.024
Rank 5 · LXL04_033652 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_245-83 aa
PF13855.13LRR_8137-197 aa
PF13855.13LRR_8187-245 aa
PF12799.14LRR_4209-245 aa
PF13855.13LRR_8259-296 aa
PF12799.14LRR_4259-295 aa
PF13855.13LRR_8299-343 aa
PF13855.13LRR_8474-512 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_033652PF08263.18LRRNT_245831.2e-1248.6
LXL04_033652PF13855.13LRR_81371978.6e-51170.3
LXL04_033652PF13855.13LRR_81872458.6e-51170.3
LXL04_033652PF12799.14LRR_42092451.9e-37127.1
LXL04_033652PF13855.13LRR_82592968.6e-51170.3
LXL04_033652PF12799.14LRR_42592951.9e-37127.1
LXL04_033652PF13855.13LRR_82993438.6e-51170.3
LXL04_033652PF13855.13LRR_84745128.6e-51170.3
LXL04_033652PF20141.5Island5305899.9e-1967.2
LXL04_033652PF23598.2LRR_145666731.6e-1970.6
LXL04_033652PF13855.13LRR_85876288.6e-51170.3
LXL04_033652PF00069.32Pkinase82210946.6e-43147.7
LXL04_033652PF07714.24PK_Tyr_Ser-Thr82410963e-41142.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9ZPS9Arabidopsis thalianaSerine/threonine-protein kinase BRI1-like 266.094%Swiss-Protstrong database homology
Q9LJF3Arabidopsis thalianaReceptor-like protein kinase BRI1-like 347.500%Swiss-Protmoderate database homology
Q9ZWC8Arabidopsis thalianaSerine/threonine-protein kinase BRI1-like 146.277%Swiss-Protmoderate database homology
Q7G768Oryza sativa subsp. japonicaBrassinosteroid LRR receptor kinase BRL260.757%Swiss-Protstrong database homology

JBrowse

View in Genome Browser