RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_033208
Reference: OH-1004 Chr: Chr07 Coordinates: 38322345-38325415 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2997 bp · LXL04_033208|LXL04_033208|OH1004|cDNA

ATGGGTTTTCTTGAGTTTTTTATTTTCGCATTAATCTCAGTTTCTTCATTTAGATGTTGCAAGAGTATTGATGATagtaatgatgatgatgatgttctaGGGCTTCTAGCATTCAAAGCCGACATTATCGACTCATCATCTCATCTATCTTCATGGAATCAAGACGACAGCTCCCCATGTTCCTGGAAGTTCGTAACGTGTAATCCGGCCACCGGAAGAGTCACCGAGGTGTCTCTCGTCGGCTTAGGTCTCTCCGGGAA...

CDS

Download CDS FASTA

2997 bp · LXL04_033208|LXL04_033208|OH1004|CDS

ATGGGTTTTCTTGAGTTTTTTATTTTCGCATTAATCTCAGTTTCTTCATTTAGATGTTGCAAGAGTATTGATGATAGTAATGATGATGATGATGTTCTAGGGCTTCTAGCATTCAAAGCCGACATTATCGACTCATCATCTCATCTATCTTCATGGAATCAAGACGACAGCTCCCCATGTTCCTGGAAGTTCGTAACGTGTAATCCGGCCACCGGAAGAGTCACCGAGGTGTCTCTCGTCGGCTTAGGTCTCTCCGGGAA...

Protein

Download Protein FASTA

998 aa · LXL04_033208|LXL04_033208|OH1004|PROTEIN

MGFLEFFIFALISVSSFRCCKSIDDSNDDDDVLGLLAFKADIIDSSSHLSSWNQDDSSPCSWKFVTCNPATGRVTEVSLVGLGLSGKIGRGLEKLQNLQVLSLARNNLTGNLNPHLNNLQALNISGNFFSGSIPPSLINSGRIKFLDLSENYLSGPIPSDTFSTCSSLRVLSLSKNDLQGPIPSSISQCTSLNHLNLSKNRFSGTPDFSTGLWLLTRIRTLDLSHNALSGRVPNGVSGLHYLKELLLQHNHFSGGLPSDM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_033208
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_033208
LocationChr07:38322345-38325415 (-)
DescriptionSimilar to At3g28040: Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g28040 Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040. No verified direct reference in this release
At3g56370 Probable LRR receptor-like serine/threonine-protein kinase IRK. No verified direct reference in this release
At5g01890 Leucine-rich repeat receptor-like protein kinase that may play a role in vascular tissues development. No verified direct reference in this release
At4g28650 Involved in the regulation of procambium maintenance and polarity during vascular-tissue development.
A receptor heteromer mediates the male perception of female attractants in plants.2016 · DOI: 10.1038/nature16975
At3g49670 LRR-rich receptor-like kinase (LRR-RLK) implicated in the detection of the CLAVATA-family peptides (CLEs), and to the regulation of the triggered signaling required for protophloem differentiation and meristems maintenance through the phosphorylation of CIK proteins (CIKs) and, probably, of PBL34, PBL35 and PBL36. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_033208 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0006468 protein phosphorylation Biological Process
GO:0009755 hormone-mediated signaling pathway Biological Process
GO:0009934 regulation of meristem structural organization Biological Process
GO:0010067 procambium histogenesis Biological Process
GO:0010075 regulation of meristem growth Biological Process
GO:0010087 phloem or xylem histogenesis Biological Process
GO:0010183 pollen tube guidance Biological Process
GO:0030154 cell differentiation Biological Process
GO:0046777 protein autophosphorylation Biological Process
GO:0048229 gametophyte development Biological Process
GO:0048364 root development Biological Process
GO:0048437 floral organ development Biological Process
KEGG gene cross-reference
ath:AT3G28040
ath:AT3G49670
ath:AT3G56370
ath:AT4G28650
ath:AT5G01890
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.869
Rank 1 · LXL04_033208 · OH-1004
Endoplasmic reticulum0.084
Rank 2 · LXL04_033208 · OH-1004
Cytoplasm0.062
Rank 3 · LXL04_033208 · OH-1004
Nucleus0.050
Rank 4 · LXL04_033208 · OH-1004
Lysosome / Vacuole0.025
Rank 5 · LXL04_033208 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_229-68 aa
PF13855.13LRR_8146-202 aa
PF13855.13LRR_8215-252 aa
PF23598.2LRR_14219-341 aa
PF13855.13LRR_8265-300 aa
PF23598.2LRR_14283-346 aa
PF12799.14LRR_4289-325 aa
PF13855.13LRR_8290-348 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_033208PF08263.18LRRNT_229684.6e-1349.9
LXL04_033208PF13855.13LRR_81462026.8e-44148.2
LXL04_033208PF13855.13LRR_82152526.8e-44148.2
LXL04_033208PF23598.2LRR_142193411.3e-1970.9
LXL04_033208PF13855.13LRR_82653006.8e-44148.2
LXL04_033208PF23598.2LRR_142833461.3e-1970.9
LXL04_033208PF12799.14LRR_42893256.8e-31106.3
LXL04_033208PF13855.13LRR_82903486.8e-44148.2
LXL04_033208PF23598.2LRR_144325361.3e-1970.9
LXL04_033208PF13855.13LRR_84815406.8e-44148.2
LXL04_033208PF07714.24PK_Tyr_Ser-Thr7149846.5e-41141.1
LXL04_033208PF00069.32Pkinase7149824.1e-38132.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LRT1Arabidopsis thalianaProbably inactive leucine-rich repeat receptor-like protein kinase At3g2804058.987%Swiss-Protstrong database homology
Q9LY03Arabidopsis thalianaProbable LRR receptor-like serine/threonine-protein kinase IRK43.693%Swiss-Protmoderate database homology
Q9LZV7Arabidopsis thalianaLeucine-rich repeat receptor-like protein kinase PXC241.625%Swiss-Protmoderate database homology
Q9M0G7Arabidopsis thalianaMDIS1-interacting receptor like kinase 132.520%Swiss-Protmoderate database homology
Q9M2Z1Arabidopsis thalianaLeucine-rich repeat receptor-like serine/threonine-protein kinase BAM232.942%Swiss-Protmoderate database homology

JBrowse

View in Genome Browser