LXL04_032830 | RubberDandelionOmics

Gene overview

LXL04_032830

Reference: OH-1004 Chr: Chr07 Coordinates: 30058340-30059802 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

798 bp · LXL04_032830|LXL04_032830|OH1004|cDNA

ATGGCTTGTTCATCTGCTTCAGCTgctcttctttcttcttcaaaccctAGAAACTCCTCTTACATATCCCCCAAATCATCAACCAATCTTTCTCAAACCCTAAGTTTTTCCAACTCTTCCTCCATCAACTTCCGATCTAAGTCCCTCCGCTCTGCCCTCCCTGTTCGCGCTTCTACCACCCGTCGCAATGGATTCGTTGTCAAAGCTGGACTACCACTGGTCGGCAATGTCGCACCAGACTTCGAAGCAGAAGCTGTTTT...

CDS

Download CDS FASTA

798 bp · LXL04_032830|LXL04_032830|OH1004|CDS

ATGGCTTGTTCATCTGCTTCAGCTGCTCTTCTTTCTTCTTCAAACCCTAGAAACTCCTCTTACATATCCCCCAAATCATCAACCAATCTTTCTCAAACCCTAAGTTTTTCCAACTCTTCCTCCATCAACTTCCGATCTAAGTCCCTCCGCTCTGCCCTCCCTGTTCGCGCTTCTACCACCCGTCGCAATGGATTCGTTGTCAAAGCTGGACTACCACTGGTCGGCAATGTCGCACCAGACTTCGAAGCAGAAGCTGTTTT...

Protein

Download Protein FASTA

265 aa · LXL04_032830|LXL04_032830|OH1004|PROTEIN

MACSSASAALLSSSNPRNSSYISPKSSTNLSQTLSFSNSSSINFRSKSLRSALPVRASTTRRNGFVVKAGLPLVGNVAPDFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHAEFEKLNTEILGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLVSDVTKSISKAFNVLIEDQGIALRGLFIIDKEGVIQHSTINNLAIGRSVDETMRTLQALQFVQENPDEVCPAGWKPGEKSMKPDPKLSKE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032830`
TK1151 ID	TkA08G207910
OH-1004 ID	LXL04_032830
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032830

Location Chr07:30058340-30059802 (-)

Description Similar to BAS1: 2-Cys peroxiredoxin BAS1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g11630`	Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively.	No verified direct reference in this release
`At5g06290`	Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0537700`	Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively.	Rice NTRC is a high-efficiency redox system for chloroplast protection against oxidative damage.2006 · DOI: 10.1105/tpc.106.041541

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032830 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006979 response to oxidative stress Biological Process

GO:0009409 response to cold Biological Process

GO:0033554 cellular response to stress Biological Process

GO:0042744 hydrogen peroxide catabolic process Biological Process

GO:0045454 cell redox homeostasis Biological Process

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0010319 stromule Cellular Component

KEGG gene cross-reference

ath:AT3G11630

ath:AT5G06290

dosa:Os02g0537700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.985

Rank 1 · LXL04_032830 · OH-1004

Mitochondrion0.029

Rank 2 · LXL04_032830 · OH-1004

Cytoplasm0.017

Rank 3 · LXL04_032830 · OH-1004

Nucleus0.012

Rank 4 · LXL04_032830 · OH-1004

Peroxisome0.010

Rank 5 · LXL04_032830 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00578.28AhpC-TSA74-207 aa

PF08534.17Redoxin74-210 aa

PF10417.151-cysPrx_C228-262 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032830	`PF00578.28`	AhpC-TSA	74	207	3.2e-41	140.9
LXL04_032830	`PF08534.17`	Redoxin	74	210	1.2e-13	51.8
LXL04_032830	`PF10417.15`	1-cysPrx_C	228	262	1.6e-11	44.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q96291`	Arabidopsis thaliana	2-Cys peroxiredoxin BAS1, chloroplastic	91.667%	Swiss-Prot	strong database homology
`Q9C5R8`	Arabidopsis thaliana	2-Cys peroxiredoxin BAS1-like, chloroplastic	88.018%	Swiss-Prot	strong database homology
`Q6ER94`	Oryza sativa subsp. japonica	2-Cys peroxiredoxin BAS1, chloroplastic	72.593%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card