LXL04_032805 | RubberDandelionOmics

Gene overview

LXL04_032805

Reference: OH-1004 Chr: Chr07 Coordinates: 29605629-29608073 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1515 bp · LXL04_032805|LXL04_032805|OH1004|cDNA

ATGGATTCTCAGATCTATGGTGCATTAAGCCTCATCGTCATCTTCCTCGCTGTTAATGTAAACGCATTGCCGGTACAAACGCCCAAATCTAGCTCTACTCAGATTAATTCCAACTCGGTTCTGGTAGCACTTCTCGATTCGCACTACACAGAGCTATCCGAGCTCGTTGAGAAGGCACTTCTTCTACAGACGCTGGAGCAAGCGGTTTCTCATCACAACATCACCATTTTTGCACCCAATAATGAAGCTCTTGAGAGACA...

CDS

Download CDS FASTA

1515 bp · LXL04_032805|LXL04_032805|OH1004|CDS

ATGGATTCTCAGATCTATGGTGCATTAAGCCTCATCGTCATCTTCCTCGCTGTTAATGTAAACGCATTGCCGGTACAAACGCCCAAATCTAGCTCTACTCAGATTAATTCCAACTCGGTTCTGGTAGCACTTCTCGATTCGCACTACACAGAGCTATCCGAGCTCGTTGAGAAGGCACTTCTTCTACAGACGCTGGAGCAAGCGGTTTCTCATCACAACATCACCATTTTTGCACCCAATAATGAAGCTCTTGAGAGACA...

Protein

Download Protein FASTA

504 aa · LXL04_032805|LXL04_032805|OH1004|PROTEIN

MDSQIYGALSLIVIFLAVNVNALPVQTPKSSSTQINSNSVLVALLDSHYTELSELVEKALLLQTLEQAVSHHNITIFAPNNEALERQMDPEFKRFLLEPRNLKSLQNLLLYHIIPSRVGSKQWPEEHVIHHQTLCVEESDNRLPLTRGISGEKMVGGLARVVRPDDVIRPDGLIHGIERLLVPRSVQEDFNRRRSLSSISAVLPEGAPVVDPRTHRLKKPATPAPAGAPPALPVYDALAPGPSLAPAPAPGPGGPRHHFD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032805`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032805

Location Chr07:29605629-29608073 (+)

Description Similar to FLA17: Fasciclin-like arabinogalactan protein 17

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g06390`	May be a cell surface adhesion protein.	No verified direct reference in this release
`At2g35860`	May be a cell surface adhesion protein.	No verified direct reference in this release
`At3g11700`	May be a cell surface adhesion protein.	No verified direct reference in this release
`At3g52370`	May be a cell surface adhesion protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032805 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0099503 secretory vesicle Cellular Component

KEGG gene cross-reference

ath:AT2G35860

ath:AT3G11700

ath:AT3G52370

ath:AT5G06390

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.227

Rank 1 · LXL04_032805 · OH-1004

Cell membrane0.169

Rank 2 · LXL04_032805 · OH-1004

Lysosome / Vacuole0.158

Rank 3 · LXL04_032805 · OH-1004

Endoplasmic reticulum0.137

Rank 4 · LXL04_032805 · OH-1004

Plastid0.123

Rank 5 · LXL04_032805 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02469.28Fasciclin48-183 aa

PF02469.28Fasciclin297-410 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032805	`PF02469.28`	Fasciclin	48	183	1.1e-31	110.3
LXL04_032805	`PF02469.28`	Fasciclin	297	410	1.1e-31	110.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q66GR0`	Arabidopsis thaliana	Fasciclin-like arabinogalactan protein 17	73.548%	Swiss-Prot	strong database homology
`Q8RWC5`	Arabidopsis thaliana	Fasciclin-like arabinogalactan protein 16	76.566%	Swiss-Prot	strong database homology
`Q93W32`	Arabidopsis thaliana	Fasciclin-like arabinogalactan protein 18	70.968%	Swiss-Prot	strong database homology
`Q9FT45`	Arabidopsis thaliana	Fasciclin-like arabinogalactan protein 15	75.059%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card