Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1600 bp · LXL04_032311|LXL04_032311|OH1004|cDNA
ACAAAGAGGCTGCCCATAAGCAGGTCTACAAAACTATTCTTAATTTGATTCGCCTTCCAGTTCCAACTATTCGAAAATGGCGATGGCAAATTTAGCCAGGCGAAAGGCGGTCAATCTGTTCAACACCGTCCCTTCCGAAGCCTTAAGGTATTCCTACTCTCTTTCATCTACCTTCACCAGAGGATTCGCATCAGGATCTGAGGAGAACGATGTCGTTGTCATCGGAGGAGGTCCAGGCGGTTACGTCGCCGCGATTAAGG...
1524 bp · LXL04_032311|LXL04_032311|OH1004|CDS
ATGGCGATGGCAAATTTAGCCAGGCGAAAGGCGGTCAATCTGTTCAACACCGTCCCTTCCGAAGCCTTAAGGTATTCCTACTCTCTTTCATCTACCTTCACCAGAGGATTCGCATCAGGATCTGAGGAGAACGATGTCGTTGTCATCGGAGGAGGTCCAGGCGGTTACGTCGCCGCGATTAAGGCTGCTCAGCTAGGGCTTAAAACTACTTGTATTGAGAAACGTGGTGCGCTTGGTGGTACTTGCCTCAATGTCGGCTG...
Protein
Download Protein FASTA507 aa · LXL04_032311|LXL04_032311|OH1004|PROTEIN
MAMANLARRKAVNLFNTVPSEALRYSYSLSSTFTRGFASGSEENDVVVIGGGPGGYVAAIKAAQLGLKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEAKTTFAKHGVKFDTVEVDLPAMMGQKDKAVSNLTKGIEGLFKKNKVTYIKGSGKFLSPSEISVDTIDGSTTTVTGKNIIIATGSDVKPLPGITIDEKRIVSSTGALALTEIPKRLIVIGAGYIGLEMGSVWGRLGSEVTVVEFAPDIVPSMDGEVRKQ...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_032311 |
|---|---|
| TK1151 ID | TkA08G165110 |
| OH-1004 ID | LXL04_032311 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 89.053 / OH-1004 59.369Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_032311 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:20285752-20288028 (+) | |||||||||
| Description | Similar to LPD: Dihydrolipoyl dehydrogenase, mitochondrial | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006103 2-oxoglutarate metabolic process Biological Process GO:0009416 response to light stimulus Biological Process GO:0019464 glycine decarboxylation via glycine cleavage system Biological Process GO:0046686 response to cadmium ion Biological Process GO:0005634 nucleus Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005759 mitochondrial matrix Cellular Component GO:0005829 cytosol Cellular Component GO:0005960 glycine cleavage complex Cellular Component GO:0045252 oxoglutarate dehydrogenase complex Cellular Component GO:0045271 respiratory chain complex I Cellular Component GO:0048046 apoplast Cellular Component | |||||||||
| KEGG gene cross-reference | ag:AAB30526 ag:AAD53185 ath:AT1G48030 ath:AT3G17240 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF07992.21Pyr_redox_245-369 aaPF12831.14FAD_oxidored45-85 aaPF01134.29GIDA45-186 aaPF00890.31FAD_binding_245-81 aaPF13450.13NAD_binding_848-83 aaPF13738.13Pyr_redox_3167-353 aaPF00070.34Pyr_redox216-292 aaPF02852.29Pyr_redox_dim388-497 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_032311 | PF07992.21 | Pyr_redox_2 | 45 | 369 | 3.1e-74 | 250.7 |
| LXL04_032311 | PF12831.14 | FAD_oxidored | 45 | 85 | 1.1e-12 | 48.7 |
| LXL04_032311 | PF01134.29 | GIDA | 45 | 186 | 5e-12 | 46.3 |
| LXL04_032311 | PF00890.31 | FAD_binding_2 | 45 | 81 | 1.9e-08 | 34.7 |
| LXL04_032311 | PF13450.13 | NAD_binding_8 | 48 | 83 | 1.6e-07 | 32.2 |
| LXL04_032311 | PF13738.13 | Pyr_redox_3 | 167 | 353 | 2.6e-10 | 40.8 |
| LXL04_032311 | PF00070.34 | Pyr_redox | 216 | 292 | 2.3e-25 | 89.6 |
| LXL04_032311 | PF02852.29 | Pyr_redox_dim | 388 | 497 | 6.2e-41 | 139.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.