LXL04_032281 | RubberDandelionOmics

Gene overview

LXL04_032281

Reference: OH-1004 Chr: Chr07 Coordinates: 19906089-19907955 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1275 bp · LXL04_032281|LXL04_032281|OH1004|cDNA

ATGGAGATTTCTTTCATGGTGTCGAAAACAGGTACTCGAATTCTCCCAAAACCCAAACCTCAATCCCGTTCTGCTCTTGAAGACAACGACAAAGTTGACGTTCCTCCTCAACTTCATCAAATTCAATCTCCTAGTACGCGAAAGAGATCGGTTGATGACACCGAACATGTTGCTGGAATTTTAGATGCAGAAGAAGTATCCTTTATCTTAAACATCTTCCCAGATGGATACACAATCAAAAACCCCTCTGAGGGCAACCT...

CDS

Download CDS FASTA

1275 bp · LXL04_032281|LXL04_032281|OH1004|CDS

ATGGAGATTTCTTTCATGGTGTCGAAAACAGGTACTCGAATTCTCCCAAAACCCAAACCTCAATCCCGTTCTGCTCTTGAAGACAACGACAAAGTTGACGTTCCTCCTCAACTTCATCAAATTCAATCTCCTAGTACGCGAAAGAGATCGGTTGATGACACCGAACATGTTGCTGGAATTTTAGATGCAGAAGAAGTATCCTTTATCTTAAACATCTTCCCAGATGGATACACAATCAAAAACCCCTCTGAGGGCAACCT...

Protein

Download Protein FASTA

424 aa · LXL04_032281|LXL04_032281|OH1004|PROTEIN

MEISFMVSKTGTRILPKPKPQSRSALEDNDKVDVPPQLHQIQSPSTRKRSVDDTEHVAGILDAEEVSFILNIFPDGYTIKNPSEGNLSHQNTAQNDPNLLCPYNKTSESLFAAIDCGRLPADFLDDIHFKYSNGAVVCEVRDYRRDSCEQGVSGLFTVSSPSITKISLKMSLDNVVKDIDQFSDNAWTYGDTMEAESRVLKDPTPNLTRLCNSLKLNLNISGIRRKRLRQIYGAVTVSDNNLEKVINTQQDPVNCMSKVP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032281`
TK1151 ID	TkA08G163540
OH-1004 ID	LXL04_032281
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032281

Location Chr07:19906089-19907955 (-)

Description Similar to PHL: Protein PHYTOCHROME-DEPENDENT LATE-FLOWERING

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g72390`	Triggers photoperiod-monitored flowering by repressing PHYB-dependent flowering negative regulation, probably through physical interactions with PHYB and CO.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032281 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009908 flower development Biological Process

GO:0048510 regulation of timing of transition from vegetative to reproductive phase Biological Process

GO:0048574 long-day photoperiodism, flowering Biological Process

GO:0000124 SAGA complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016604 nuclear body Cellular Component

GO:0003712 transcription coregulator activity Molecular Function

KEGG gene cross-reference

ath:AT1G72390

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.969

Rank 1 · LXL04_032281 · OH-1004

Cytoplasm0.110

Rank 2 · LXL04_032281 · OH-1004

Cell membrane0.018

Rank 3 · LXL04_032281 · OH-1004

Mitochondrion0.010

Rank 4 · LXL04_032281 · OH-1004

Endoplasmic reticulum0.008

Rank 5 · LXL04_032281 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12090.14Spt20_SEP64-208 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032281	`PF12090.14`	Spt20_SEP	64	208	3.9e-15	56.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IDB2`	Arabidopsis thaliana	Protein PHYTOCHROME-DEPENDENT LATE-FLOWERING	38.983%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card