LXL04_032245 | RubberDandelionOmics

Gene overview

LXL04_032245

Reference: OH-1004 Chr: Chr07 Coordinates: 19141757-19143703 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1221 bp · LXL04_032245|LXL04_032245|OH1004|cDNA

ATGGAAGTTCTGTCAAGCTCTGTTTTCACACCCATCTTCCATGAGACGCGCTCCTCCTCTACCCCTTCTGCTACGCTCAAAACAAACTTCTGCTTCCCTAAAACTAGACTTTCCGGATTCGGATCTCGAGGTCTCGCCGCTGCTGCTCGTAAAGTTTCAGGAAACGGCGAAGATGATGAACAATCACTTGTTGATAATGCCTTTGCATTGATTCCTGAACAACCTGCAGCTTTTTCTCTGTTAATAGACCGATACTTCAA...

CDS

Download CDS FASTA

1221 bp · LXL04_032245|LXL04_032245|OH1004|CDS

ATGGAAGTTCTGTCAAGCTCTGTTTTCACACCCATCTTCCATGAGACGCGCTCCTCCTCTACCCCTTCTGCTACGCTCAAAACAAACTTCTGCTTCCCTAAAACTAGACTTTCCGGATTCGGATCTCGAGGTCTCGCCGCTGCTGCTCGTAAAGTTTCAGGAAACGGCGAAGATGATGAACAATCACTTGTTGATAATGCCTTTGCATTGATTCCTGAACAACCTGCAGCTTTTTCTCTGTTAATAGACCGATACTTCAA...

Protein

Download Protein FASTA

406 aa · LXL04_032245|LXL04_032245|OH1004|PROTEIN

MEVLSSSVFTPIFHETRSSSTPSATLKTNFCFPKTRLSGFGSRGLAAAARKVSGNGEDDEQSLVDNAFALIPEQPAAFSLLIDRYFNRLLKLCSDGFSHFLKDNSSQTHGIENVKSTSDTITPTSTHGAGSGSGGGTRAGLFRTPISGGVQSATSVHDLPRPALAVRNLMEQARFAHLCTVMSRMHHRREGYPFGSLVDFAPDPMGHPIFSFSPLAIHTRNLLADPRCTLVVQIPGWSGLSNARVTIFGDVYPLPEDQQE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032245`
TK1151 ID	TkA08G161010
OH-1004 ID	LXL04_032245
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032245

Location Chr07:19141757-19143703 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g03890`	Dimeric beta-barrel protein binding to heme and catalyzing its degradation to produce biliverdin.	The Arabidopsis locus AT3G03890 encodes a dimeric β-barrel protein implicated in heme degradation.2020 · DOI: 10.1042/bcj20200712

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032245 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0033014 tetrapyrrole biosynthetic process Biological Process

GO:0042167 heme catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016491 oxidoreductase activity Molecular Function

GO:0020037 heme binding Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G03890

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.886

Rank 1 · LXL04_032245 · OH-1004

Mitochondrion0.097

Rank 2 · LXL04_032245 · OH-1004

Cytoplasm0.072

Rank 3 · LXL04_032245 · OH-1004

Nucleus0.051

Rank 4 · LXL04_032245 · OH-1004

Cell membrane0.028

Rank 5 · LXL04_032245 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13883.14CREG_beta-barrel165-311 aa

PF01243.28PNPOx_N167-274 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032245	`PF13883.14`	CREG_beta-barrel	165	311	5.3e-17	63.0
LXL04_032245	`PF01243.28`	PNPOx_N	167	274	5e-06	27.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LDU1`	Arabidopsis thaliana	Non-canonical heme oxygenase HOZ, chloroplastic	29.126%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card