LXL04_032240 | RubberDandelionOmics

Gene overview

LXL04_032240

Reference: OH-1004 Chr: Chr07 Coordinates: 19116330-19118107 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1416 bp · LXL04_032240|LXL04_032240|OH1004|cDNA

ATGAGGAAGTTGAGATGGGTGATGGACGGCGATGGGTTCTGGGACTTAGACGTCTCCACTCCGGCCACCCTCAACGGCGTCGCCCGACCAGTACCCGGTGACCCAATCCCATCTGTACTCGGATTGTCTAGAGGGATTCGTCTTTCGAGACCCAAACAGGTCGACTTCTTCCAGCGGTTCATGTTCATGCCGTTTATCCCTTCCTACTCCAATGCTAGTCCTCATGCTCATGGAAACGGCTTCTCTCTTCAACGAGTTCT...

CDS

Download CDS FASTA

1416 bp · LXL04_032240|LXL04_032240|OH1004|CDS

ATGAGGAAGTTGAGATGGGTGATGGACGGCGATGGGTTCTGGGACTTAGACGTCTCCACTCCGGCCACCCTCAACGGCGTCGCCCGACCAGTACCCGGTGACCCAATCCCATCTGTACTCGGATTGTCTAGAGGGATTCGTCTTTCGAGACCCAAACAGGTCGACTTCTTCCAGCGGTTCATGTTCATGCCGTTTATCCCTTCCTACTCCAATGCTAGTCCTCATGCTCATGGAAACGGCTTCTCTCTTCAACGAGTTCT...

Protein

Download Protein FASTA

471 aa · LXL04_032240|LXL04_032240|OH1004|PROTEIN

MRKLRWVMDGDGFWDLDVSTPATLNGVARPVPGDPIPSVLGLSRGIRLSRPKQVDFFQRFMFMPFIPSYSNASPHAHGNGFSLQRVLSLPFALDRWFGTVLGQLNVQKLASSIKKNGFRQPNDESPWFQNIARHLSDKSLYAIDFCSEFFLTPDDSLQLSVESYGDDDYKTPRKKAIFHHKFQNHNLTLEAASPGLFVDKNGGFWDVPLTMAIDLASVSSEIGPSYHICVNHNSGSPTTFGGHKTDAIPASLQPGLSATT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032240`
TK1151 ID	TkA08G160780
OH-1004 ID	LXL04_032240
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.400
Protein coverage (%)	TK1151 97.015 / OH-1004 41.401 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032240

Location Chr07:19116330-19118107 (-)

Description Similar to TGD4: Protein TRIGALACTOSYLDIACYLGLYCEROL 4, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g06960`	Involved in lipid transfer from the endoplasmic reticulum (ER) to plastids.	Lipid trafficking between the endoplasmic reticulum and the plastid in Arabidopsis requires the extraplastidic TGD4 protein.2008 · DOI: 10.1105/tpc.108.061176 Lipid transport mediated by Arabidopsis TGD proteins is unidirectional from the endoplasmic reticulum to the plastid.2010 · DOI: 10.1093/pcp/pcq053 TGD4 involved in endoplasmic reticulum-to-chloroplast lipid trafficking is a phosphatidic acid binding protein.2012 · DOI: 10.1111/j.1365-313x.2012.04900.x The phosphatidic acid binding site of the Arabidopsis trigalactosyldiacylglycerol 4 (TGD4) protein required for lipid import into chloroplasts.2013 · DOI: 10.1074/jbc.m112.438986

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032240 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0034196 acylglycerol transport Biological Process

GO:1990052 ER to chloroplast lipid transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009707 chloroplast outer membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0016020 membrane Cellular Component

GO:0042803 protein homodimerization activity Molecular Function

GO:0070300 phosphatidic acid binding Molecular Function

KEGG gene cross-reference

ath:AT3G06960

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.728

Rank 1 · LXL04_032240 · OH-1004

Mitochondrion0.155

Rank 2 · LXL04_032240 · OH-1004

Cytoplasm0.091

Rank 3 · LXL04_032240 · OH-1004

Nucleus0.074

Rank 4 · LXL04_032240 · OH-1004

Endoplasmic reticulum0.064

Rank 5 · LXL04_032240 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M903`	Arabidopsis thaliana	Protein TRIGALACTOSYLDIACYLGLYCEROL 4, chloroplastic	55.072%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card