LXL04_032079 | RubberDandelionOmics

Gene overview

LXL04_032079

Reference: OH-1004 Chr: Chr07 Coordinates: 16461410-16462263 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

561 bp · LXL04_032079|LXL04_032079|OH1004|cDNA

tacacacacactaACAAACTCCCTTCCTTTTCACTTTCACCCATCGAATCAAACTCATCCAAAACGGGTGTTCCTTTGTGTTTGCTTGGATTCGGTGCAGTTCGCCTGCGTACCGACATGAATCGCTTACTTTCCCTCCTCTTCCACCAAGGCGTTCTCGATGAACAGTTCTTGCAACTCCAACACCTCCAAGATCAAACCTCCCCCAACTTCGTCTCCGACGTCGTCACAATCTACTTCCATGAATCAGAAAAACTGCT...

CDS

Download CDS FASTA

486 bp · LXL04_032079|LXL04_032079|OH1004|CDS

TTGTGTTTGCTTGGATTCGGTGCAGTTCGCCTGCGTACCGACATGAATCGCTTACTTTCCCTCCTCTTCCACCAAGGCGTTCTCGATGAACAGTTCTTGCAACTCCAACACCTCCAAGATCAAACCTCCCCCAACTTCGTCTCCGACGTCGTCACAATCTACTTCCATGAATCAGAAAAACTGCTTCGAAATCTCCGAACCCTACTGTTGGATAAGGAGATATGGGATTACGTTAAGCTTGGAATACATTTGAATCAGTT...

Protein

Download Protein FASTA

161 aa · LXL04_032079|LXL04_032079|OH1004|PROTEIN

MCLLGFGAVRLRTDMNRLLSLLFHQGVLDEQFLQLQHLQDQTSPNFVSDVVTIYFHESEKLLRNLRTLLLDKEIWDYVKLGIHLNQLMGSSSSIGAKRVRNICAAFRAAVEQNNRPACMRALEVLEHEYCYLKNKLHELFQMEQQRVLGDAVRYPGVVHQQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032079`
TK1151 ID	TkA08G148630
OH-1004 ID	LXL04_032079
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	98.800
Protein coverage (%)	TK1151 76.415 / OH-1004 50.311 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032079

Location Chr07:16461410-16462263 (+)

Description Similar to AHP6: Pseudo histidine-containing phosphotransfer protein 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g80100`	Functions as a two-component phosphorelay mediator between cytokinin sensor histidine kinases and response regulators (B-type ARRs).	No verified direct reference in this release
`At5g39340`	Functions as a two-component phosphorelay mediators between cytokinin sensor histidine kinases and response regulator (B-type ARRs).	Histidine-containing phosphotransfer (HPt) signal transducers implicated in His-to-Asp phosphorelay in Arabidopsis.1998 · DOI: 10.1093/oxfordjournals.pcp.a029329
`At3g21510`	Functions as a two-component phosphorelay mediators between cytokinin sensor histidine kinases and response regulator (B-type ARRs).	No verified direct reference in this release
`At3g29350`	Functions as a two-component phosphorelay mediators between cytokinin sensor histidine kinases and response regulator (B-type ARRs).	Characterization of genes for two-component phosphorelay mediators with a single HPt domain in Arabidopsis thaliana.1998 · DOI: 10.1016/s0014-5793(98)01188-0
`At1g03430`	Functions as a two-component phosphorelay mediator between cytokinin sensor histidine kinases and response regulators (B-type ARRs).	Comparative studies of the AHP histidine-containing phosphotransmitters implicated in His-to-Asp phosphorelay in Arabidopsis thaliana.2004 · DOI: 10.1271/bbb.68.462

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032079 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000160 phosphorelay signal transduction system Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009557 antipodal cell differentiation Biological Process

GO:0009560 embryo sac egg cell differentiation Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0009825 multidimensional cell growth Biological Process

GO:0010089 xylem development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT1G03430

ath:AT1G80100

ath:AT3G21510

ath:AT3G29350

ath:AT5G39340

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.617

Rank 1 · LXL04_032079 · OH-1004

Nucleus0.335

Rank 2 · LXL04_032079 · OH-1004

Mitochondrion0.109

Rank 3 · LXL04_032079 · OH-1004

Cell membrane0.087

Rank 4 · LXL04_032079 · OH-1004

Endoplasmic reticulum0.061

Rank 5 · LXL04_032079 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01627.29Hpt50-129 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032079	`PF01627.29`	Hpt	50	129	1.4e-09	38.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SSC9`	Arabidopsis thaliana	Pseudo histidine-containing phosphotransfer protein 6	71.895%	Swiss-Prot	strong database homology
`Q9SAZ5`	Arabidopsis thaliana	Histidine-containing phosphotransfer protein 3	43.382%	Swiss-Prot	moderate database homology
`Q9ZNV9`	Arabidopsis thaliana	Histidine-containing phosphotransfer protein 1	51.587%	Swiss-Prot	strong database homology
`Q9ZNV8`	Arabidopsis thaliana	Histidine-containing phosphotransfer protein 2	39.568%	Swiss-Prot	moderate database homology
`Q8L9T7`	Arabidopsis thaliana	Histidine-containing phosphotransfer protein 5	40.323%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card