LXL04_030717 | RubberDandelionOmics

Gene overview

LXL04_030717

Reference: OH-1004 Chr: Chr06 Coordinates: 121347322-121348939 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1176 bp · LXL04_030717|LXL04_030717|OH1004|cDNA

CATTGCATACTTCACATTTACTCTCTATCTCTCTTCTTGTCTCTAATATACACACATTCTCACACACTCACTGTGTGTGAGGTTTTCACTTCTGTTTTTAGAACGATTCCACTTGGGTTTCTTTTCTTGTTTTCAGATAATATGGGTTTAACGTCTCTTCAAGTCTGTATGGACTCTTCTGACTGGTTTCAGgGTACAATTCAGGAAGAAATAGGAATGGATTCATCATCACCTTCAGGAATGACGGATCCCATGCTTGC...

CDS

Download CDS FASTA

1140 bp · LXL04_030717|LXL04_030717|OH1004|CDS

TTGTCTCTAATATACACACATTCTCACACACTCACTGTGTGTGAGGTTTTCACTTCTGTTTTTAGAACGATTCCACTTGGGTTTCTTTTCTTGTTTTCAGATAATATGGGTTTAACGTCTCTTCAAGTCTGTATGGACTCTTCTGACTGGTTTCAGGGTACAATTCAGGAAGAAATAGGAATGGATTCATCATCACCTTCAGGAATGACGGATCCCATGCTTGCATGCTCGCGGCCATTAATGGAGAGAAGACTCCGACC...

Protein

Download Protein FASTA

379 aa · LXL04_030717|LXL04_030717|OH1004|PROTEIN

MSLIYTHSHTLTVCEVFTSVFRTIPLGFLFLFSDNMGLTSLQVCMDSSDWFQGTIQEEIGMDSSSPSGMTDPMLACSRPLMERRLRPQQDQALKCPRCDSTHTKFCYYNNYSLTQPRYFCKTCRRYWTKGGTLRNIPVGGGCRKNKKVSSNSKKSTSATANNHNNDNNVNIHHQTHQHNPHLINPNHNLIMNSTDLQLSYPESSMQFAASNLFGIGNPSNIPSFMFENLNSSATRAIDFMENNGGNVGGGNGNQFLGIMG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030717`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030717

Location Chr06:121347322-121348939 (+)

Description Similar to DOF5.6: Dof zinc finger protein DOF5.6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g62940`	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity).	Dof5.6/HCA2, a Dof transcription factor gene, regulates interfascicular cambium formation and vascular tissue development in Arabidopsis.2009 · DOI: 10.1105/tpc.108.064139 Mobile PEAR transcription factors integrate positional cues to prime cambial growth.2019 · DOI: 10.1038/s41586-018-0839-y
`At5g60200`	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity).	Mobile PEAR transcription factors integrate positional cues to prime cambial growth.2019 · DOI: 10.1038/s41586-018-0839-y
`At4g24060`	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence.	No verified direct reference in this release
`At3g45610`	Transcription factor that negatively affects seed germination and opposes TCP14 function in the regulation of a specific set of abscisic acid-related genes.	Arabidopsis thaliana DOF6 negatively affects germination in non-after-ripened seeds and interacts with TCP14.2012 · DOI: 10.1093/jxb/err388 Mobile PEAR transcription factors integrate positional cues to prime cambial growth.2019 · DOI: 10.1038/s41586-018-0839-y

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030717 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0010067 procambium histogenesis Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048364 root development Biological Process

GO:0090057 root radial pattern formation Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G45610

ath:AT4G24060

ath:AT5G60200

ath:AT5G62940

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.969

Rank 1 · LXL04_030717 · OH-1004

Cytoplasm0.107

Rank 2 · LXL04_030717 · OH-1004

Cell membrane0.025

Rank 3 · LXL04_030717 · OH-1004

Endoplasmic reticulum0.017

Rank 4 · LXL04_030717 · OH-1004

Plastid0.011

Rank 5 · LXL04_030717 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02701.21Zn_ribbon_Dof90-147 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030717	`PF02701.21`	Zn_ribbon_Dof	90	147	6.4e-34	116.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FM03`	Arabidopsis thaliana	Dof zinc finger protein DOF5.6	57.558%	Swiss-Prot	weak database homology
`Q84TE9`	Arabidopsis thaliana	Dof zinc finger protein DOF5.3	70.588%	Swiss-Prot	weak database homology
`Q8LAP8`	Arabidopsis thaliana	Dof zinc finger protein DOF4.6	80.303%	Swiss-Prot	weak database homology
`Q9M1E6`	Arabidopsis thaliana	Dof zinc finger protein DOF3.2	69.737%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card