LXL04_030588 | RubberDandelionOmics

Gene overview

LXL04_030588

Reference: OH-1004 Chr: Chr06 Coordinates: 119292217-119304199 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

6286 bp · LXL04_030588|LXL04_030588|OH1004|cDNA

CACTACTTCACCGTTCCTCTACGACCGGACTGTCTTCCCGCCATCACAAAGAAGAAAAAGCAAAATGTTACTCGAACTGCCTCGATTAACCAACTCCCTGAGGGATCCATTCGACGCCGATCAAGCTTACATCAATCGCAAATCCATCCTTCAATCATTCAACACTCGTCGCAGCTCTGGGAAGTCAGCTGACGAATTCGAAGTTGCTCGAAAGATTGTTCATCAATGGGACGAAGCTTCTGTTGAAGTCTGCCAAGCAT...

CDS

Download CDS FASTA

6222 bp · LXL04_030588|LXL04_030588|OH1004|CDS

ATGTTACTCGAACTGCCTCGATTAACCAACTCCCTGAGGGATCCATTCGACGCCGATCAAGCTTACATCAATCGCAAATCCATCCTTCAATCATTCAACACTCGTCGCAGCTCTGGGAAGTCAGCTGACGAATTCGAAGTTGCTCGAAAGATTGTTCATCAATGGGACGAAGCTTCTGTTGAAGTCTGCCAAGCATACAAACAATTTGTTGGGGCAGTGGTTGAGTTGATTGATGGAGTGGTGATCAATGAAGAGTTCAA...

Protein

Download Protein FASTA

2073 aa · LXL04_030588|LXL04_030588|OH1004|PROTEIN

MLLELPRLTNSLRDPFDADQAYINRKSILQSFNTRRSSGKSADEFEVARKIVHQWDEASVEVCQAYKQFVGAVVELIDGVVINEEFKEVALAVYRLFGTHGEEEEANKRIIEKKSELQKLLGYSVSDAKLQKVVKAAQSLSKLQPDNHNLTLTENKVNENDDGQEFGADLVFHHPTRFLVDESVDDVEIWGEGSNVTSTSIQGGWYDNSEVTNHHPVGGTFDLGWLRDECSKIVNSSSSQFPQDELAMAICRVLDSDKAG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030588`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030588

Location Chr06:119292217-119304199 (+)

Description Similar to BRR2C: DExH-box ATP-dependent RNA helicase DExH14

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g61140`	RNA helicase that plays an essential role in pre-mRNA splicing as component of the U5 snRNP and U4/U6-U5 tri-snRNP complexes.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030588 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006260 DNA replication Biological Process

GO:0006307 DNA alkylation repair Biological Process

GO:0006397 mRNA processing Biological Process

GO:0006513 protein monoubiquitination Biological Process

GO:0008380 RNA splicing Biological Process

GO:0032790 ribosome disassembly Biological Process

GO:0071569 protein ufmylation Biological Process

GO:0072344 rescue of stalled cytosolic ribosome Biological Process

GO:0140708 CAT tailing Biological Process

GO:1990116 ribosome-associated ubiquitin-dependent protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

KEGG gene cross-reference

ath:AT5G61140

bta:538416

gga:421790

hsa:10973

mmu:77987

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.821

Rank 1 · LXL04_030588 · OH-1004

Cytoplasm0.225

Rank 2 · LXL04_030588 · OH-1004

Mitochondrion0.046

Rank 3 · LXL04_030588 · OH-1004

Cell membrane0.019

Rank 4 · LXL04_030588 · OH-1004

Endoplasmic reticulum0.011

Rank 5 · LXL04_030588 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24557.3DExH14_plug46-145 aa

PF00270.36DEAD440-614 aa

PF04851.22ResIII447-613 aa

PF00271.38Helicase_C729-817 aa

PF23445.2WHD_SNRNP200848-921 aa

PF02889.22Sec63939-1246 aa

PF00270.36DEAD1288-1456 aa

PF04851.22ResIII1288-1421 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030588	`PF24557.3`	DExH14_plug	46	145	5.5e-41	140.1
LXL04_030588	`PF00270.36`	DEAD	440	614	9e-61	205.2
LXL04_030588	`PF04851.22`	ResIII	447	613	4.6e-26	92.4
LXL04_030588	`PF00271.38`	Helicase_C	729	817	2.4e-21	76.7
LXL04_030588	`PF23445.2`	WHD_SNRNP200	848	921	2.2e-51	172.7
LXL04_030588	`PF02889.22`	Sec63	939	1246	9.5e-155	513.9
LXL04_030588	`PF00270.36`	DEAD	1288	1456	9e-61	205.2
LXL04_030588	`PF04851.22`	ResIII	1288	1421	4.6e-26	92.4
LXL04_030588	`PF00271.38`	Helicase_C	1562	1649	2.4e-21	76.7
LXL04_030588	`PF23445.2`	WHD_SNRNP200	1680	1761	2.2e-51	172.7
LXL04_030588	`PF02889.22`	Sec63	1767	2072	9.5e-155	513.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FNQ1`	Arabidopsis thaliana	DExH-box ATP-dependent RNA helicase DExH14	76.953%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card