Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1947 bp · LXL04_030476|LXL04_030476|OH1004|cDNA
ATGACTCCTGCATCATCATCGGCATCAACAGCGCTGCCAGGTTGCAAACGAACCTCGTTACGAATCAACCCAAAAACTCTGCGGATTCCCGTATCGGGTTCATCTTGTCACATTGATTTCCTGAAATCAATATCCAACCCCAAATGTCTTTTTAAGACCAATAGTAAGATGCGAATTCCCAAAACACTCACCGTTTCATTGTGCTTCTCTTTTCTATACTCTTCGCCTTCTCGTTGTCCCCAATTTCCTTCTTTGGTTCC...
1947 bp · LXL04_030476|LXL04_030476|OH1004|CDS
ATGACTCCTGCATCATCATCGGCATCAACAGCGCTGCCAGGTTGCAAACGAACCTCGTTACGAATCAACCCAAAAACTCTGCGGATTCCCGTATCGGGTTCATCTTGTCACATTGATTTCCTGAAATCAATATCCAACCCCAAATGTCTTTTTAAGACCAATAGTAAGATGCGAATTCCCAAAACACTCACCGTTTCATTGTGCTTCTCTTTTCTATACTCTTCGCCTTCTCGTTGTCCCCAATTTCCTTCTTTGGTTCC...
Protein
Download Protein FASTA648 aa · LXL04_030476|LXL04_030476|OH1004|PROTEIN
MTPASSSASTALPGCKRTSLRINPKTLRIPVSGSSCHIDFLKSISNPKCLFKTNSKMRIPKTLTVSLCFSFLYSSPSRCPQFPSLVPDLGFRSSRRFFTTKRSQGRFPLKSSYKMEAPSDGTTTTETPFEKSQVSSVWASPNGGQKIEIGKNIFCNRAVNMKNIVAVGFDMDYTLAQYKPETFESLAYNGTVKKLVTNLGYPNELLDWSFDWTYMVRGLVLDKKRGNILKMDRHKYVKVAYHGFRLLSKDEKVATYGNTL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_030476 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_030476 |
|---|---|
| Location | Chr06:116790831-116794770 (+) |
| Description | Similar to NT5C2: Cytosolic purine 5'-nucleotidase |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000255 allantoin metabolic process Biological Process GO:0006204 IMP catabolic process Biological Process GO:0046037 GMP metabolic process Biological Process GO:0046040 IMP metabolic process Biological Process GO:0046054 dGMP metabolic process Biological Process GO:0046055 dGMP catabolic process Biological Process GO:0046085 adenosine metabolic process Biological Process GO:0050689 negative regulation of defense response to virus by host Biological Process GO:0070936 protein K48-linked ubiquitination Biological Process GO:0140374 antiviral innate immune response Biological Process GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component |
| KEGG gene cross-reference | bta:281951 hsa:22978 mmu:76952 pon:100172749 rno:100363253 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF05761.215_nucleotid153-643 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_030476 | PF05761.21 | 5_nucleotid | 153 | 643 | 7.6e-171 | 569.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.