LXL04_030469 | RubberDandelionOmics

Gene overview

LXL04_030469

Reference: OH-1004 Chr: Chr06 Coordinates: 116591310-116592223 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

669 bp · LXL04_030469|LXL04_030469|OH1004|cDNA

ATGGCGGGAATTCTTGGCGCCATACGACATACCCTCTCTTTGACTGACTATTTCATCCCTTATAAACCCTACTCCTATTACAATCTACATTCAGTTCGTTCTTCTCTCTTCATTCGCTCATCTAAATTATCATCCTACCGGTTAATTTCAGCCATGCCAGACATCAACAACAGCGGTGACGTCGAAGGACCGACCCCAAAGGTTCAGAAAATCGGCGACCGGATTAGAGACTCCGACTACCAACTGCCTCTTTTCAAAGT...

CDS

Download CDS FASTA

669 bp · LXL04_030469|LXL04_030469|OH1004|CDS

ATGGCGGGAATTCTTGGCGCCATACGACATACCCTCTCTTTGACTGACTATTTCATCCCTTATAAACCCTACTCCTATTACAATCTACATTCAGTTCGTTCTTCTCTCTTCATTCGCTCATCTAAATTATCATCCTACCGGTTAATTTCAGCCATGCCAGACATCAACAACAGCGGTGACGTCGAAGGACCGACCCCAAAGGTTCAGAAAATCGGCGACCGGATTAGAGACTCCGACTACCAACTGCCTCTTTTCAAAGT...

Protein

Download Protein FASTA

222 aa · LXL04_030469|LXL04_030469|OH1004|PROTEIN

MAGILGAIRHTLSLTDYFIPYKPYSYYNLHSVRSSLFIRSSKLSSYRLISAMPDINNSGDVEGPTPKVQKIGDRIRDSDYQLPLFKVKKLSEKAILPARGSSLAAGYDLSSATDTKVPARGKALVPTDLSIAVPEGTYARIAPRSGLAWKHSIDVGAGVVDADYRGPVGVILFNHSDTDLEVKAGDRIAQLIIQKIITPEVMEVDDLDSTVRGAGGFGSTGV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030469`
TK1151 ID	TkA07G405190
OH-1004 ID	LXL04_030469
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030469

Location Chr06:116591310-116592223 (+)

Description Similar to Deoxyuridine 5'-triphosphate nucleotidohydrolase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g46940`	This enzyme is involved in nucleotide metabolism: it produces dUMP, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dUTP, preventing uracil incorporation into DNA.	The SOS screen in Arabidopsis: a search for functions involved in DNA metabolism.2010 · DOI: 10.1016/j.dnarep.2010.02.009

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0669100`	This enzyme is involved in nucleotide metabolism: it produces dUMP, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dUTP, preventing uracil incorporation into DNA.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030469 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006226 dUMP biosynthetic process Biological Process

GO:0006281 DNA repair Biological Process

GO:0009213 pyrimidine deoxyribonucleoside triphosphate catabolic process Biological Process

GO:0035863 dITP catabolic process Biological Process

GO:0046081 dUTP catabolic process Biological Process

GO:0046104 thymidine metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0004170 dUTP diphosphatase activity Molecular Function

KEGG gene cross-reference

ath:AT3G46940

ddi:DDB_G0293374

dosa:Os03g0669100

sly:544274

spo:2543669

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.528

Rank 1 · LXL04_030469 · OH-1004

Plastid0.380

Rank 2 · LXL04_030469 · OH-1004

Cytoplasm0.149

Rank 3 · LXL04_030469 · OH-1004

Nucleus0.060

Rank 4 · LXL04_030469 · OH-1004

Peroxisome0.046

Rank 5 · LXL04_030469 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00692.25dUTPase93-221 aa

PF22769.2DCD121-195 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030469	`PF00692.25`	dUTPase	93	221	8.6e-46	155.6
LXL04_030469	`PF22769.2`	DCD	121	195	2.1e-08	35.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9STG6`	Arabidopsis thaliana	Deoxyuridine 5'-triphosphate nucleotidohydrolase	79.268%	Swiss-Prot	strong database homology
`Q10FF9`	Oryza sativa subsp. japonica	Deoxyuridine 5'-triphosphate nucleotidohydrolase	82.143%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card