LXL04_030306 | RubberDandelionOmics

Gene overview

LXL04_030306

Reference: OH-1004 Chr: Chr06 Coordinates: 113934398-113935302 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

393 bp · LXL04_030306|LXL04_030306|OH1004|cDNA

ATGGCTTCTCGCTCCCTCTTATTCTCCTCCATAACTACTCTCTTTGTCATCTTCATCATCAGCATATCATCATCCATGGCAGAAACCGATTCGTCTGTTCCCAAATCTGAATCAGTGCCACTAGAAGCGGCAGTTCATATCGTTTACACCGATCGCCCTCAACACGAAGAGCTCGAAATTTATCACCTTCGCACCCTCTCTTCCGTCTTCGCCAGCGAGGAGGCAGCAAAAGGGGCTTTATTGTACACGTACAAACACGC...

CDS

Download CDS FASTA

393 bp · LXL04_030306|LXL04_030306|OH1004|CDS

ATGGCTTCTCGCTCCCTCTTATTCTCCTCCATAACTACTCTCTTTGTCATCTTCATCATCAGCATATCATCATCCATGGCAGAAACCGATTCGTCTGTTCCCAAATCTGAATCAGTGCCACTAGAAGCGGCAGTTCATATCGTTTACACCGATCGCCCTCAACACGAAGAGCTCGAAATTTATCACCTTCGCACCCTCTCTTCCGTCTTCGCCAGCGAGGAGGCAGCAAAAGGGGCTTTATTGTACACGTACAAACACGC...

Protein

Download Protein FASTA

130 aa · LXL04_030306|LXL04_030306|OH1004|PROTEIN

MASRSLLFSSITTLFVIFIISISSSMAETDSSVPKSESVPLEAAVHIVYTDRPQHEELEIYHLRTLSSVFASEEAAKGALLYTYKHAACGFSAKLTPEQVEEISKQPGVLQVVPSRTVQLHDKPVNVHHF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030306`
TK1151 ID	TkA07G396200
OH-1004 ID	LXL04_030306
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 80.769 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030306

Location Chr06:113934398-113935302 (-)

Description Similar to SBT3.17: Subtilisin-like protease SBT3.17

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g66220`	Subtilisin-like protease SBT3.17.	No verified direct reference in this release
`At4g21326`	Subtilisin-like protease SBT3.12.	No verified direct reference in this release
`At4g10510`	Subtilisin-like protease SBT3.7.	No verified direct reference in this release
`At4g21650`	Subtilisin-like protease SBT3.13.	No verified direct reference in this release
`At5g11940`	Subtilisin-like protease SBT3.11.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030306 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005615 extracellular space Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004252 serine-type endopeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G66220

ath:AT4G10510

ath:AT4G21650

ath:AT5G11940

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.302

Rank 1 · LXL04_030306 · OH-1004

Endoplasmic reticulum0.245

Rank 2 · LXL04_030306 · OH-1004

Extracellular0.242

Rank 3 · LXL04_030306 · OH-1004

Cytoplasm0.143

Rank 4 · LXL04_030306 · OH-1004

Cell membrane0.107

Rank 5 · LXL04_030306 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05922.22Inhibitor_I946-121 aa

PF21864.2MORF_dom53-126 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030306	`PF05922.22`	Inhibitor_I9	46	121	7.6e-16	59.3
LXL04_030306	`PF21864.2`	MORF_dom	53	126	1.8e-07	31.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C7U8`	Arabidopsis thaliana	Subtilisin-like protease SBT3.17	44.304%	Swiss-Prot	moderate database homology
`F4JJH5`	Arabidopsis thaliana	Subtilisin-like protease SBT3.12	37.500%	Swiss-Prot	moderate database homology
`Q9SZY2`	Arabidopsis thaliana	Subtilisin-like protease SBT3.7	39.744%	Swiss-Prot	moderate database homology
`Q8GUK4`	Arabidopsis thaliana	Subtilisin-like protease SBT3.13	36.585%	Swiss-Prot	moderate database homology
`Q1PDX5`	Arabidopsis thaliana	Subtilisin-like protease SBT3.11	37.349%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card