Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2724 bp · LXL04_029833|LXL04_029833|OH1004|cDNA
ATGGAAAGTCGGATGGTGCTACACGCGCCTGATGAAGTTATTACCGAGCTTACCGGTGCCGACACTGAGTTAGTGAGCAGATCATGGAACTTATTTGCTATACTGCTATCCTTAGGGCATCCAGTTCTTCCTATTGAACTGGCATCTCGATGCACTTCTTTTGAAGTGTCAACGGAATTTGTCGAATTCGTTTGTTCTATACCTAACTCTCCCCTCTCGCTGACGGATGATGGTTTGGTTACGATTTCTTCTGCTGTTTG...
2724 bp · LXL04_029833|LXL04_029833|OH1004|CDS
ATGGAAAGTCGGATGGTGCTACACGCGCCTGATGAAGTTATTACCGAGCTTACCGGTGCCGACACTGAGTTAGTGAGCAGATCATGGAACTTATTTGCTATACTGCTATCCTTAGGGCATCCAGTTCTTCCTATTGAACTGGCATCTCGATGCACTTCTTTTGAAGTGTCAACGGAATTTGTCGAATTCGTTTGTTCTATACCTAACTCTCCCCTCTCGCTGACGGATGATGGTTTGGTTACGATTTCTTCTGCTGTTTG...
Protein
Download Protein FASTA907 aa · LXL04_029833|LXL04_029833|OH1004|PROTEIN
MESRMVLHAPDEVITELTGADTELVSRSWNLFAILLSLGHPVLPIELASRCTSFEVSTEFVEFVCSIPNSPLSLTDDGLVTISSAVCMRLQRFLLSSGRLFKISIPREIETRDCERKRACGDVELMYYRKRKRSRPNISDNADQTALAMPVRISDAFEKVYAHDDDHALRSLIITNDNIPVEGTINMSALINFDGGLLTTGLNDCKDEDENDSTTVLSTKELAIQNNFLNGFICFPSPIKTQSRKRKDCSQFQPSSHLTA...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_029833 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_029833 |
|---|---|
| Location | Chr06:101421134-101425083 (+) |
| Description | Similar to CDC7: Cell division cycle 7-related protein kinase |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000076 DNA replication checkpoint signaling Biological Process GO:0000082 G1/S transition of mitotic cell cycle Biological Process GO:0000727 double-strand break repair via break-induced replication Biological Process GO:0006270 DNA replication initiation Biological Process GO:0007165 signal transduction Biological Process GO:0008284 positive regulation of cell population proliferation Biological Process GO:0010571 positive regulation of nuclear cell cycle DNA replication Biological Process GO:0010971 positive regulation of G2/M transition of mitotic cell cycle Biological Process GO:0031573 mitotic intra-S DNA damage checkpoint signaling Biological Process GO:0033314 mitotic DNA replication checkpoint signaling Biological Process GO:0035556 intracellular signal transduction Biological Process GO:0044770 cell cycle phase transition Biological Process |
| KEGG gene cross-reference | ddi:DDB_G0292152 dme:Dmel_CG5790 hsa:8317 spo:2541165 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00069.32Pkinase440-582 aaPF07714.24PK_Tyr_Ser-Thr441-612 aaPF00069.32Pkinase747-884 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_029833 | PF00069.32 | Pkinase | 440 | 582 | 1.4e-46 | 159.7 |
| LXL04_029833 | PF07714.24 | PK_Tyr_Ser-Thr | 441 | 612 | 1.1e-14 | 55.1 |
| LXL04_029833 | PF00069.32 | Pkinase | 747 | 884 | 1.4e-46 | 159.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.