Gene Card
Gene overview
cDNA / CDS / Protein Sequences
810 bp · LXL04_029451|LXL04_029451|OH1004|cDNA
ATGGTGGTTTTAAGCTACCAAGTTCTTCAATTTCCAAAAACTAATCTCCACCGATGTCCCACCATAAAACCcgaccaccgccaccgccaccatgGCGGCGGATTCGTCCGGTGTGGGATAGCAGAGCCGTCAGGGAAGCCAGCACCAATGGGGCAAAAGACAAAGTATAATGACGGGGTGTTTGAGAAGGTGTTCATGAGCTTATTTGCTCGGAAAATGGAAAAGTTTTCCGGCAAAGGGAATAAAGAAAGCGAGGGTAA...
810 bp · LXL04_029451|LXL04_029451|OH1004|CDS
ATGGTGGTTTTAAGCTACCAAGTTCTTCAATTTCCAAAAACTAATCTCCACCGATGTCCCACCATAAAACCCGACCACCGCCACCGCCACCATGGCGGCGGATTCGTCCGGTGTGGGATAGCAGAGCCGTCAGGGAAGCCAGCACCAATGGGGCAAAAGACAAAGTATAATGACGGGGTGTTTGAGAAGGTGTTCATGAGCTTATTTGCTCGGAAAATGGAAAAGTTTTCCGGCAAAGGGAATAAAGAAAGCGAGGGTAA...
Protein
Download Protein FASTA269 aa · LXL04_029451|LXL04_029451|OH1004|PROTEIN
MVVLSYQVLQFPKTNLHRCPTIKPDHRHRHHGGGFVRCGIAEPSGKPAPMGQKTKYNDGVFEKVFMSLFARKMEKFSGKGNKESEGKEKGLFDYDYESFVDVSRSVMVGRNRLQQQEVVREVLMSMLPPGAPEQFRKLFPPTKWAAEFNAALTVPFFHWLVGPSEVVEVEVNGVKQRSGVHIKKCRYLENSGCVGMCVNMCKIPTQDFFTNEFGLPLTMIPNFEDMSCEMVYGQTPPPFIEDPVATQPCFAEICSVANPK...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_029451 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_029451 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr06:90872074-90874068 (-) | ||||||||||||
| Description | Similar to D27: Beta-carotene isomerase D27, chloroplastic | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0010223 secondary shoot formation Biological Process GO:1901601 strigolactone biosynthetic process Biological Process GO:0005634 nucleus Cellular Component GO:0009507 chloroplast Cellular Component GO:0009536 plastid Cellular Component GO:0005506 iron ion binding Molecular Function GO:0016859 cis-trans isomerase activity Molecular Function GO:0106365 beta-carotene isomerase activity Molecular Function | ||||||||||||
| KEGG gene cross-reference | ath:AT1G03055 mtr:25485781 osa:107276001 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF13225.12D27-like_C159-239 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_029451 | PF13225.12 | D27-like_C | 159 | 239 | 6.6e-39 | 132.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.