LXL04_029171 | RubberDandelionOmics

Gene overview

LXL04_029171

Reference: OH-1004 Chr: Chr06 Coordinates: 82265380-82280057 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1572 bp · LXL04_029171|LXL04_029171|OH1004|cDNA

ATGGGATACACTTCACTTCAATTCTTAAGAAGCACCATGAAACAACAATCACCACCTCATCTTACCCCATGGATCCTCTTTAACAAGTTCAGCAGTTGGGTTTTATTTTGTGTGTTTCTTGTGCCGATAGTTTCCTCGGAGATTAGTGAGTCACGGTTCCAGGTTAAGACACTACCAGGTTTGCTTGGTGATATACCTTTCACACTTGAAACTGGTTATATTGGGGTCGGAGAATCCGATGAGGTGCAATTATTTTACTA...

CDS

Download CDS FASTA

1572 bp · LXL04_029171|LXL04_029171|OH1004|CDS

ATGGGATACACTTCACTTCAATTCTTAAGAAGCACCATGAAACAACAATCACCACCTCATCTTACCCCATGGATCCTCTTTAACAAGTTCAGCAGTTGGGTTTTATTTTGTGTGTTTCTTGTGCCGATAGTTTCCTCGGAGATTAGTGAGTCACGGTTCCAGGTTAAGACACTACCAGGTTTGCTTGGTGATATACCTTTCACACTTGAAACTGGTTATATTGGGGTCGGAGAATCCGATGAGGTGCAATTATTTTACTA...

Protein

Download Protein FASTA

523 aa · LXL04_029171|LXL04_029171|OH1004|PROTEIN

MGYTSLQFLRSTMKQQSPPHLTPWILFNKFSSWVLFCVFLVPIVSSEISESRFQVKTLPGLLGDIPFTLETGYIGVGESDEVQLFYYFVESQGSPKDDPLILWLTGGPGCSGLSGILYEIGPFTINYANSTFEKTMLEINPHSWTKMANIIFIDQPAGTGFSYAKTPEAYITNDTLSTKYTYHFLRKWLVGHPKFLNNPLYLGSVSYGGIMLPMVVQEIYNGNEVGKQPQMNIKGYMLGNPQTDKSVDYNARIKFAHRTA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029171`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029171

Location Chr06:82265380-82280057 (-)

Description Similar to SCPL18: Serine carboxypeptidase-like 18

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g33540`	Probable carboxypeptidase.	No verified direct reference in this release
`At3g12203`	Probable carboxypeptidase.	No verified direct reference in this release
`At5g09640`	Involved in plants secondary metabolism.	The sng2 mutant of Arabidopsis is defective in the gene encoding the serine carboxypeptidase-like protein sinapoylglucose:choline sinapoyltransferase.2001 · DOI: 10.1046/j.1365-313x.2001.01123.x Benzoylation and sinapoylation of glucosinolate R-groups in Arabidopsis.2012 · DOI: 10.1111/j.1365-313x.2012.05096.x
`At1g73300`	Probable carboxypeptidase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029171 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0019748 secondary metabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004185 serine-type carboxypeptidase activity Molecular Function

GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups Molecular Function

GO:0016752 sinapoyltransferase activity Molecular Function

GO:0047202 sinapoylglucose-choline O-sinapoyltransferase activity Molecular Function

KEGG gene cross-reference

ag:QGI57842

ath:AT1G33540

ath:AT1G73300

ath:AT3G12203

ath:AT5G09640

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.491

Rank 1 · LXL04_029171 · OH-1004

Extracellular0.149

Rank 2 · LXL04_029171 · OH-1004

Endoplasmic reticulum0.123

Rank 3 · LXL04_029171 · OH-1004

Cell membrane0.107

Rank 4 · LXL04_029171 · OH-1004

Cytoplasm0.098

Rank 5 · LXL04_029171 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00450.29Peptidase_S1059-498 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029171	`PF00450.29`	Peptidase_S10	59	498	7.8e-121	405.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C7Z9`	Arabidopsis thaliana	Serine carboxypeptidase-like 18	46.593%	Swiss-Prot	moderate database homology
`Q9C7D6`	Arabidopsis thaliana	Serine carboxypeptidase-like 17	42.340%	Swiss-Prot	moderate database homology
`Q8VZU3`	Arabidopsis thaliana	Serine carboxypeptidase-like 19	43.432%	Swiss-Prot	moderate database homology
`Q9CAU3`	Arabidopsis thaliana	Serine carboxypeptidase-like 2	45.045%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card