LXL04_029161 | RubberDandelionOmics

Gene overview

LXL04_029161

Reference: OH-1004 Chr: Chr06 Coordinates: 82082290-82085152 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2154 bp · LXL04_029161|LXL04_029161|OH1004|cDNA

ATGGAGGCATTCCTTAAAGAGATTTAACATCTTAAAATCCAATTGGAAGAGATAAAGTCGGCTACCAGCGACTTTAATAAGAATAACGTTATTGGTAAAGGTGGATTTGGGATTGTGTACAAAGGAGTGCTCGTTCATTCTAAGGGGAAAAGCATGGTTGCTTTTAAGCGTCTTGATCGTAAGTATGGGCAAGGAGACCCTGAGTTCTTGAAAGAGATCGTCATGCTCTCCCGTTACACACATGAAAATCTCATCTCTCT...

CDS

Download CDS FASTA

2112 bp · LXL04_029161|LXL04_029161|OH1004|CDS

TTGGAAGAGATAAAGTCGGCTACCAGCGACTTTAATAAGAATAACGTTATTGGTAAAGGTGGATTTGGGATTGTGTACAAAGGAGTGCTCGTTCATTCTAAGGGGAAAAGCATGGTTGCTTTTAAGCGTCTTGATCGTAAGTATGGGCAAGGAGACCCTGAGTTCTTGAAAGAGATCGTCATGCTCTCCCGTTACACACATGAAAATCTCATCTCTCTCCTGGGATTTTGCGACAATGATGGTGAGAAGATACTAGTATA...

Protein

Download Protein FASTA

703 aa · LXL04_029161|LXL04_029161|OH1004|PROTEIN

MEEIKSATSDFNKNNVIGKGGFGIVYKGVLVHSKGKSMVAFKRLDRKYGQGDPEFLKEIVMLSRYTHENLISLLGFCDNDGEKILVYEYASHGSLDRHLEGATLMWRQRLKICLDAAKGLCYLHDSKGTQQRVIHRDIKASNILLDENWNAKISDMGLSKIGPADQPHSFLATNVVGTPGYIDPVYMETYSLTKESDVYSFGMVLFEVLCGRLCFEYNNGHFKSLWPMWRKSYEENKLDEIILEKLKQQISQNSLQTFSR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029161`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029161

Location Chr06:82082290-82085152 (+)

Description Similar to At2g23200: Probable receptor-like protein kinase At2g23200

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g38990`	Probable receptor-like protein kinase At5g38990.	No verified direct reference in this release
`At5g39000`	Putative receptor-like protein kinase At5g39000.	No verified direct reference in this release
`At2g23200`	Probable receptor-like protein kinase At2g23200.	No verified direct reference in this release
`At5g59700`	Probable receptor-like protein kinase At5g59700.	No verified direct reference in this release
`At3g46290`	Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.	Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029161 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009741 response to brassinosteroid Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0010038 response to metal ion Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010483 pollen tube reception Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009536 plastid Cellular Component

GO:0043680 filiform apparatus Cellular Component

GO:0004672 protein kinase activity Molecular Function

KEGG gene cross-reference

ath:AT2G23200

ath:AT3G46290

ath:AT5G38990

ath:AT5G39000

ath:AT5G59700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.515

Rank 1 · LXL04_029161 · OH-1004

Nucleus0.350

Rank 2 · LXL04_029161 · OH-1004

Cell membrane0.251

Rank 3 · LXL04_029161 · OH-1004

Endoplasmic reticulum0.075

Rank 4 · LXL04_029161 · OH-1004

Lysosome / Vacuole0.056

Rank 5 · LXL04_029161 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase11-281 aa

PF07714.24PK_Tyr_Ser-Thr13-283 aa

PF14299.14PP2332-464 aa

PF14299.14PP2535-701 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029161	`PF00069.32`	Pkinase	11	281	4.9e-43	148.2
LXL04_029161	`PF07714.24`	PK_Tyr_Ser-Thr	13	283	4.8e-44	151.3
LXL04_029161	`PF14299.14`	PP2	332	464	8.7e-22	78.4
LXL04_029161	`PF14299.14`	PP2	535	701	8.7e-22	78.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FID9`	Arabidopsis thaliana	Probable receptor-like protein kinase At5g38990	45.752%	Swiss-Prot	weak database homology
`Q9FID8`	Arabidopsis thaliana	Putative receptor-like protein kinase At5g39000	46.078%	Swiss-Prot	weak database homology
`O22187`	Arabidopsis thaliana	Probable receptor-like protein kinase At2g23200	43.323%	Swiss-Prot	weak database homology
`Q9FN92`	Arabidopsis thaliana	Probable receptor-like protein kinase At5g59700	45.687%	Swiss-Prot	weak database homology
`Q9LX66`	Arabidopsis thaliana	Receptor-like protein kinase HERK 1	45.513%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card