LXL04_029141 | RubberDandelionOmics

Gene overview

LXL04_029141

Reference: OH-1004 Chr: Chr06 Coordinates: 81783361-81787411 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2151 bp · LXL04_029141|LXL04_029141|OH1004|cDNA

ATGGCAGCTAGTAGTAGCATAGAGGATCTTACGGAGGATCTTCTCAATGTCGAGTTGGAGCTTCAGGATGTTCAAGATGAAATAAAGAACTTGCTTGATAAACAAGAGAAGCTCTACGAGAAACAGTCAGAACTTAGGGCCGTGTTGGAAAGTTATCACGGATTGGAAAAATCTGATAAAGAAGATGCAGCTCCACAACCAGAAAACTGGTCAGGCTCTTTCGAATGGGACAATAGAGCAGATGATATCAGATTTAATAT...

CDS

Download CDS FASTA

2151 bp · LXL04_029141|LXL04_029141|OH1004|CDS

ATGGCAGCTAGTAGTAGCATAGAGGATCTTACGGAGGATCTTCTCAATGTCGAGTTGGAGCTTCAGGATGTTCAAGATGAAATAAAGAACTTGCTTGATAAACAAGAGAAGCTCTACGAGAAACAGTCAGAACTTAGGGCCGTGTTGGAAAGTTATCACGGATTGGAAAAATCTGATAAAGAAGATGCAGCTCCACAACCAGAAAACTGGTCAGGCTCTTTCGAATGGGACAATAGAGCAGATGATATCAGATTTAATAT...

Protein

Download Protein FASTA

716 aa · LXL04_029141|LXL04_029141|OH1004|PROTEIN

MAASSSIEDLTEDLLNVELELQDVQDEIKNLLDKQEKLYEKQSELRAVLESYHGLEKSDKEDAAPQPENWSGSFEWDNRADDIRFNIFGIPTYRANQREIINAIMSGRDVLVIMAAGGGKSLCYQLPAVLHHGIALVVSPLLSLIQDQVMGLTALGIPASMLTSTTSKEHEKFIYQALEKGEGDLKVLYVTPEKISKSKRFVSKLEKCHHAGRLSLISIDEAHCCSQWGHDFRPDYKNLGILKTQFPNVPVVALTATATK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029141`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029141

Location Chr06:81783361-81787411 (+)

Description Similar to RECQL2: ATP-dependent DNA helicase Q-like 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g31360`	3'-5' DNA helicase that may play a role in the repair of DNA.	AtRECQ2, a RecQ helicase homologue from Arabidopsis thaliana, is able to disrupt various recombinogenic DNA structures in vitro.2008 · DOI: 10.1111/j.0960-7412.2008.03511.x Biochemical characterization of AtRECQ3 reveals significant differences relative to other RecQ helicases.2009 · DOI: 10.1104/pp.109.144709 Fork sensing and strand switching control antagonistic activities of RecQ helicases.2013 · DOI: 10.1038/ncomms3024

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029141 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0006260 DNA replication Biological Process

GO:0006281 DNA repair Biological Process

GO:0006310 DNA recombination Biological Process

GO:0031297 replication fork processing Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005694 chromosome Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0016020 membrane Cellular Component

GO:0016592 mediator complex Cellular Component

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G31360

hsa:5965

mmu:19691

pon:100171554

rno:312824

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.797

Rank 1 · LXL04_029141 · OH-1004

Cytoplasm0.235

Rank 2 · LXL04_029141 · OH-1004

Mitochondrion0.070

Rank 3 · LXL04_029141 · OH-1004

Cell membrane0.033

Rank 4 · LXL04_029141 · OH-1004

Endoplasmic reticulum0.022

Rank 5 · LXL04_029141 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00270.36DEAD95-263 aa

PF00271.38Helicase_C305-411 aa

PF16124.11RecQ_Zn_bind424-478 aa

PF09382.18RQC484-589 aa

PF00570.29HRDC607-669 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029141	`PF00270.36`	DEAD	95	263	5.6e-27	95.2
LXL04_029141	`PF00271.38`	Helicase_C	305	411	6.8e-21	75.3
LXL04_029141	`PF16124.11`	RecQ_Zn_bind	424	478	4.4e-10	40.8
LXL04_029141	`PF09382.18`	RQC	484	589	7e-09	36.2
LXL04_029141	`PF00570.29`	HRDC	607	669	1.1e-09	38.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FT73`	Arabidopsis thaliana	ATP-dependent DNA helicase Q-like 2	68.917%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card