LXL04_029060 | RubberDandelionOmics

Gene overview

LXL04_029060

Reference: OH-1004 Chr: Chr06 Coordinates: 79497145-79499855 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1794 bp · LXL04_029060|LXL04_029060|OH1004|cDNA

ATGAAGCTAAAAGATGATAAGCCCACGAGGCCATATGAGAAAAGCTCGAAGGTACCAATGGGGATAATGTTTGTTGTATTGTGCGGGTTTTCGTTCTATCTTGGTGGGATCTTTTGTTCTGACAAGAACACATTAGTCACTGAAGAAGTTGTGAAATCGGTTGAATCTCCCAAAAAGGCTATTTCTACTCCGGTTCAAGTGAAATCAGTATCGTTCCCTGAATGTAGTGCTGATTTACAAGATTACACGCCCTGCACTGA...

CDS

Download CDS FASTA

1794 bp · LXL04_029060|LXL04_029060|OH1004|CDS

ATGAAGCTAAAAGATGATAAGCCCACGAGGCCATATGAGAAAAGCTCGAAGGTACCAATGGGGATAATGTTTGTTGTATTGTGCGGGTTTTCGTTCTATCTTGGTGGGATCTTTTGTTCTGACAAGAACACATTAGTCACTGAAGAAGTTGTGAAATCGGTTGAATCTCCCAAAAAGGCTATTTCTACTCCGGTTCAAGTGAAATCAGTATCGTTCCCTGAATGTAGTGCTGATTTACAAGATTACACGCCCTGCACTGA...

Protein

Download Protein FASTA

597 aa · LXL04_029060|LXL04_029060|OH1004|PROTEIN

MKLKDDKPTRPYEKSSKVPMGIMFVVLCGFSFYLGGIFCSDKNTLVTEEVVKSVESPKKAISTPVQVKSVSFPECSADLQDYTPCTDPKRWMKYGRHRLTFMERHCPPAFDRKECLVPPPNGYKEPIRWPKSKNECWYRNVPYDWINKQKSNQHWLRKEGEKFYFPGGGTMFPNGVSAYVDLMQNLIPGMKDGTVRTAIDTGCGVASWGGDLLDRGILTISLAPRDNHEAQVQFALERGIPAILGIISTQRLPFPSNSFD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029060`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029060

Location Chr06:79497145-79499855 (-)

Description Similar to At1g31850: Probable methyltransferase PMT20

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g31850`	Probable methyltransferase PMT20.	No verified direct reference in this release
`At4g19120`	Probable methyltransferase PMT21.	No verified direct reference in this release
`At2g45750`	Probable methyltransferase PMT16.	No verified direct reference in this release
`At4g10440`	Probable methyltransferase PMT17.	No verified direct reference in this release
`At4g00750`	Probable methyltransferase PMT15.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029060 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0032259 methylation Biological Process

GO:0000138 Golgi trans cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005768 endosome Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005797 Golgi medial cisterna Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G31850

ath:AT2G45750

ath:AT4G00750

ath:AT4G10440

ath:AT4G19120

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.764

Rank 1 · LXL04_029060 · OH-1004

Endoplasmic reticulum0.077

Rank 2 · LXL04_029060 · OH-1004

Cell membrane0.071

Rank 3 · LXL04_029060 · OH-1004

Extracellular0.070

Rank 4 · LXL04_029060 · OH-1004

Cytoplasm0.037

Rank 5 · LXL04_029060 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03141.23Methyltransf_2981-588 aa

PF13649.13Methyltransf_25199-290 aa

PF08241.19Methyltransf_11200-293 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029060	`PF03141.23`	Methyltransf_29	81	588	2e-215	716.9
LXL04_029060	`PF13649.13`	Methyltransf_25	199	290	8.2e-06	27.1
LXL04_029060	`PF08241.19`	Methyltransf_11	200	293	3.8e-08	34.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C6S7`	Arabidopsis thaliana	Probable methyltransferase PMT20	75.377%	Swiss-Prot	strong database homology
`Q94II3`	Arabidopsis thaliana	Probable methyltransferase PMT21	76.756%	Swiss-Prot	strong database homology
`O80844`	Arabidopsis thaliana	Probable methyltransferase PMT16	48.237%	Swiss-Prot	moderate database homology
`Q9SZX8`	Arabidopsis thaliana	Probable methyltransferase PMT17	46.904%	Swiss-Prot	moderate database homology
`Q9ZPH9`	Arabidopsis thaliana	Probable methyltransferase PMT15	46.382%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card