LXL04_028362 | RubberDandelionOmics

Gene overview

LXL04_028362

Reference: OH-1004 Chr: Chr06 Coordinates: 39063833-39067818 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1707 bp · LXL04_028362|LXL04_028362|OH1004|cDNA

ACCCCCTCCTCTTTCTCGAAGCACATAAAATTACATAAGCAGCGCTGTTTCCCAAAGAAAAAACTCAGAGACCCAGAACAAAAAATCAAACTCTTTGTTTCACTCACACTTATCAAGAAACTAATGAACATGGATTCTTCTCAATCTCATCAtcagaatcaaaacaacaactgGCTTGCCTTCTCTCTTTCCAACACCAATAACCTCTTCCAACAGCCTCACGCGACTGCCTTCCACCATCACCATGAAGGAGATGCCGA...

CDS

Download CDS FASTA

1584 bp · LXL04_028362|LXL04_028362|OH1004|CDS

ATGAACATGGATTCTTCTCAATCTCATCATCAGAATCAAAACAACAACTGGCTTGCCTTCTCTCTTTCCAACACCAATAACCTCTTCCAACAGCCTCACGCGACTGCCTTCCACCATCACCATGAAGGAGATGCCGATACCCGGACAACCACCCATCATGAATTGTCTGTTCTCACCGACGGTAGCCCAAAACTGGAAGACTTCCTCGGCGGCTGTGGCTCCGCCGCCTCTACTGGATCTGGTCCCGACGTTTGTCATTT...

Protein

Download Protein FASTA

527 aa · LXL04_028362|LXL04_028362|OH1004|PROTEIN

MNMDSSQSHHQNQNNNWLAFSLSNTNNLFQQPHATAFHHHHEGDADTRTTTHHELSVLTDGSPKLEDFLGGCGSAASTGSGPDVCHFQDESQTCIQPVDTASFYDSELKTIATSFLRGFSTDNHQQLNQQLAVVATPPQQDISPAKKAIDTFGQRTSIYRGIKSFASNVKGIDGREDMKLIYGIIVAEEKGKVEKEDKALATVDNYCMAVYAILRLFMGGYDKEDKAARAYDLAALKYWGPTTTTNFPVCNYEKELDEMK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028362`
TK1151 ID	TkA07G146830
OH-1004 ID	LXL04_028362
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	87.000
Protein coverage (%)	TK1151 90.039 / OH-1004 90.133 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028362

Location Chr06:39063833-39067818 (+)

Description Similar to AIL5: AP2-like ethylene-responsive transcription factor AIL5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g57390`	Probably acts as a transcriptional activator.	AINTEGUMENTA-like (AIL) genes are expressed in young tissues and may specify meristematic or division-competent states.2005 · DOI: 10.1007/s11103-005-0955-6
`At1g51190`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At3g20840`	Probably acts as a transcriptional activator.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028362 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000723 telomere maintenance Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007389 pattern specification process Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0009845 seed germination Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010073 meristem maintenance Biological Process

GO:0010311 lateral root formation Biological Process

GO:0010449 root meristem growth Biological Process

KEGG gene cross-reference

ath:AT1G51190

ath:AT3G20840

ath:AT5G57390

bna:106426170

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.964

Rank 1 · LXL04_028362 · OH-1004

Cytoplasm0.091

Rank 2 · LXL04_028362 · OH-1004

Cell membrane0.031

Rank 3 · LXL04_028362 · OH-1004

Endoplasmic reticulum0.026

Rank 4 · LXL04_028362 · OH-1004

Plastid0.015

Rank 5 · LXL04_028362 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6PQQ3`	Arabidopsis thaliana	AP2-like ethylene-responsive transcription factor AIL5	44.270%	Swiss-Prot	moderate database homology
`Q5YGP7`	Arabidopsis thaliana	AP2-like ethylene-responsive transcription factor PLT2	59.545%	Swiss-Prot	weak database homology
`Q5YGP8`	Arabidopsis thaliana	AP2-like ethylene-responsive transcription factor PLT1	57.447%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card