LXL04_027673 | RubberDandelionOmics

Gene overview

LXL04_027673

Reference: OH-1004 Chr: Chr06 Coordinates: 21606084-21609551 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

975 bp · LXL04_027673|LXL04_027673|OH1004|cDNA

ATGAATCACGAACAGCATCATCATCCTCGGTCAAAGAATCACGGCCCTGAGCTCATATTTCTAATATTGATAACTTACGAAGAAGGTTGTTTCGGTTGTGCGTACTTACAGGTCTTCTGGCCGAAAATCATTATCCAAAAATGGCTAAATCGTGCCTCTAAAAGTTCCGATTACACCGCCGATCCGGAGGACGAAGATAGCACATACGATTCCGAGGGCGAAGAAGACTCCTACGACTCCCCAAAAGAACTGCGATTGAA...

CDS

Download CDS FASTA

975 bp · LXL04_027673|LXL04_027673|OH1004|CDS

ATGAATCACGAACAGCATCATCATCCTCGGTCAAAGAATCACGGCCCTGAGCTCATATTTCTAATATTGATAACTTACGAAGAAGGTTGTTTCGGTTGTGCGTACTTACAGGTCTTCTGGCCGAAAATCATTATCCAAAAATGGCTAAATCGTGCCTCTAAAAGTTCCGATTACACCGCCGATCCGGAGGACGAAGATAGCACATACGATTCCGAGGGCGAAGAAGACTCCTACGACTCCCCAAAAGAACTGCGATTGAA...

Protein

Download Protein FASTA

324 aa · LXL04_027673|LXL04_027673|OH1004|PROTEIN

MNHEQHHHPRSKNHGPELIFLILITYEEGCFGCAYLQVFWPKIIIQKWLNRASKSSDYTADPEDEDSTYDSEGEEDSYDSPKELRLKVKQGDDFQTDLSVMNEREMEIGYPTDVKHVAHIGWDGSSGSAPSWVIWSGLQAIFSPPTAVRGGIPIIFPQGIRRIARKEDLLTILRQHVKSNVLHIDNKFYLQNDELITCLLKSGADPNVIDEEGWKPVQVAALRGNRGAVEVLFPMDVDVYTQETLLDKAGASCQALTDAQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027673`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027673

Location Chr06:21606084-21609551 (-)

Description Similar to RIC10: CRIB domain-containing protein RIC10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g04900`	Functions as a downstream effector of Rho-related GTP binding proteins of the 'Rho of Plants' (ROPs) family.	A genome-wide analysis of Arabidopsis Rop-interactive CRIB motif-containing proteins that act as Rop GTPase targets.2001 · DOI: 10.1105/tpc.010218
`At4g21745`	Functions as a downstream effector of Rho-related GTP binding proteins of the 'Rho of Plants' (ROPs) family.	No verified direct reference in this release
`At3g23380`	Functions as a downstream effector of Rho-related GTP binding proteins of the 'Rho of Plants' (ROPs) family.	No verified direct reference in this release
`At4g28556`	Functions as a downstream effector of Rho-related GTP binding proteins of the 'Rho of Plants' (ROPs) family.	No verified direct reference in this release
`At2g33460`	Functions as a downstream effector of Rho-related GTP binding proteins of the 'Rho of Plants' (ROPs) family.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027673 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000902 cell morphogenesis Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010215 cellulose microfibril organization Biological Process

GO:0031122 cytoplasmic microtubule organization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0010005 cortical microtubule, transverse to long axis Cellular Component

GO:0016324 apical plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT2G33460

ath:AT3G23380

ath:AT4G04900

ath:AT4G21745

ath:AT4G28556

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.347

Rank 1 · LXL04_027673 · OH-1004

Nucleus0.306

Rank 2 · LXL04_027673 · OH-1004

Cell membrane0.162

Rank 3 · LXL04_027673 · OH-1004

Mitochondrion0.145

Rank 4 · LXL04_027673 · OH-1004

Endoplasmic reticulum0.132

Rank 5 · LXL04_027673 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00786.34PBD107-128 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027673	`PF00786.34`	PBD	107	128	3.2e-06	28.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M0Y9`	Arabidopsis thaliana	CRIB domain-containing protein RIC10	72.973%	Swiss-Prot	weak database homology
`Q0WL69`	Arabidopsis thaliana	CRIB domain-containing protein RIC11	62.500%	Swiss-Prot	weak database homology
`F4J424`	Arabidopsis thaliana	CRIB domain-containing protein RIC5	70.968%	Swiss-Prot	weak database homology
`Q1G3K8`	Arabidopsis thaliana	CRIB domain-containing protein RIC7	72.727%	Swiss-Prot	weak database homology
`F4IVV0`	Arabidopsis thaliana	CRIB domain-containing protein RIC1	67.742%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card