LXL04_026978 | RubberDandelionOmics

Gene overview

LXL04_026978

Reference: OH-1004 Chr: Chr06 Coordinates: 6420787-6421618 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

498 bp · LXL04_026978|LXL04_026978|OH1004|cDNA

ATGGGAGAACCAATTGGGATTTTGAAAGTTATCGTTGTTCGAGGGAAGAACCTTGTAATCCGCGATTTCAAAACCAGTGATCCGTACGTCATCGTCAAGCTCGGAAACCAGACGGCGAAGACGAAGGTTGTTAACAGTTGCTTAAATCCCGTCTGGAATGAAGAAATGAGCTTCTCGATTATCGAACCTGTCGACGTTCTAAATTTGGAAGTGTTTGATAAAGACCGATTCAAGTCCGATGACAAGATGGGTCATGCTCA...

CDS

Download CDS FASTA

498 bp · LXL04_026978|LXL04_026978|OH1004|CDS

ATGGGAGAACCAATTGGGATTTTGAAAGTTATCGTTGTTCGAGGGAAGAACCTTGTAATCCGCGATTTCAAAACCAGTGATCCGTACGTCATCGTCAAGCTCGGAAACCAGACGGCGAAGACGAAGGTTGTTAACAGTTGCTTAAATCCCGTCTGGAATGAAGAAATGAGCTTCTCGATTATCGAACCTGTCGACGTTCTAAATTTGGAAGTGTTTGATAAAGACCGATTCAAGTCCGATGACAAGATGGGTCATGCTCA...

Protein

Download Protein FASTA

165 aa · LXL04_026978|LXL04_026978|OH1004|PROTEIN

MGEPIGILKVIVVRGKNLVIRDFKTSDPYVIVKLGNQTAKTKVVNSCLNPVWNEEMSFSIIEPVDVLNLEVFDKDRFKSDDKMGHAHINIQPLITAARLREILGVSKEGTILRKVIPEIDNCLVVESSIDWMKGEVVQDVLLRLCDVESGEIELKIKFMKVMKIL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026978`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026978

Location Chr06:6420787-6421618 (-)

Description Similar to CAR11: Protein C2-DOMAIN ABA-RELATED 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g47710`	Stimulates the GTPase/ATPase activities of Obg-like ATPases (By similarity).	No verified direct reference in this release
`At1g70790`	Stimulates the GTPase/ATPase activities of Obg-like ATPases (By similarity).	C2-domain abscisic acid-related proteins mediate the interaction of PYR/PYL/RCAR abscisic acid receptors with the plasma membrane and regulate abscisic acid sensitivity in Arabidopsis.2014 · DOI: 10.1105/tpc.114.129973 LOWER TEMPERATURE 1 Enhances ABA Responses and Plant Drought Tolerance by Modulating the Stability and Localization of C2-Domain ABA-Related Proteins in Arabidopsis.2019 · DOI: 10.1016/j.molp.2019.05.002
`At1g66360`	Stimulates the GTPase/ATPase activities of Obg-like ATPases (By similarity).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0327000`	Mediates the transient calcium-dependent interaction of PYR/PYL/RCAR abscisic acid (ABA) receptors with the plasma membrane and thus regulates ABA sensitivity (By similarity).	Constitutive expression of a rice GTPase-activating protein induces defense responses.2008 · DOI: 10.1111/j.1469-8137.2008.02473.x An ancient P-loop GTPase in rice is regulated by a higher plant-specific regulatory protein.2010 · DOI: 10.1074/jbc.m110.172080 Site-directed Mutagenesis Shows the Significance of Interactions with Phospholipids and the G-protein OsYchF1 for the Physiological Functions of the Rice GTPase-activating Protein 1 (OsGAP1).2015 · DOI: 10.1074/jbc.m115.655639
`UniProt: A2X479`	Mediates the transient calcium-dependent interaction of PYR/PYL/RCAR abscisic acid (ABA) receptors with the plasma membrane and thus regulates ABA sensitivity (By similarity).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026978 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009611 response to wounding Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

GO:0043547 positive regulation of GTPase activity Biological Process

GO:1900426 positive regulation of defense response to bacterium Biological Process

GO:1901002 positive regulation of response to salt stress Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT1G66360

ath:AT1G70790

ath:AT5G47710

dosa:Os02g0327000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.464

Rank 1 · LXL04_026978 · OH-1004

Cell membrane0.347

Rank 2 · LXL04_026978 · OH-1004

Nucleus0.271

Rank 3 · LXL04_026978 · OH-1004

Lysosome / Vacuole0.079

Rank 4 · LXL04_026978 · OH-1004

Endoplasmic reticulum0.071

Rank 5 · LXL04_026978 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00168.37C26-94 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026978	`PF00168.37`	C2	6	94	4.7e-26	91.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FIK8`	Arabidopsis thaliana	Protein C2-DOMAIN ABA-RELATED 11	66.667%	Swiss-Prot	strong database homology
`Q9S7J9`	Arabidopsis thaliana	Protein C2-DOMAIN ABA-RELATED 9	46.795%	Swiss-Prot	moderate database homology
`Q9C8Y2`	Arabidopsis thaliana	Protein C2-DOMAIN ABA-RELATED 2	43.636%	Swiss-Prot	moderate database homology
`Q6YWF1`	Oryza sativa subsp. japonica	GTPase activating protein 1	47.205%	Swiss-Prot	moderate database homology
`A2X479`	Oryza sativa subsp. indica	GTPase activating protein 1	47.205%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card