LXL04_026909 | RubberDandelionOmics

Gene overview

LXL04_026909

Reference: OH-1004 Chr: Chr06 Coordinates: 5165219-5165962 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

744 bp · LXL04_026909|LXL04_026909|OH1004|cDNA

ATGGAGAATGCATCATCCACCACCACTTcctcaaccaccaccaccaccaccggttGTTCCTCCGTttcctccacctccacctcctcctcctccaccaccgAGGAAGTAAAGCCTCAAAAGTGCTTAAAAAGATCACAAAAGGGAAACAATGGCAACGAACAAAAGAAGCAAAATAGAAATAACGATGGTGGTGAACATGATCCTATGTATCGCGGTGTACGGATGAGAAGTTGGGGCAAATGGGTATCCGAAATCCGTGA...

CDS

Download CDS FASTA

744 bp · LXL04_026909|LXL04_026909|OH1004|CDS

ATGGAGAATGCATCATCCACCACCACTTCCTCAACCACCACCACCACCACCGGTTGTTCCTCCGTTTCCTCCACCTCCACCTCCTCCTCCTCCACCACCGAGGAAGTAAAGCCTCAAAAGTGCTTAAAAAGATCACAAAAGGGAAACAATGGCAACGAACAAAAGAAGCAAAATAGAAATAACGATGGTGGTGAACATGATCCTATGTATCGCGGTGTACGGATGAGAAGTTGGGGCAAATGGGTATCCGAAATCCGTGA...

Protein

Download Protein FASTA

247 aa · LXL04_026909|LXL04_026909|OH1004|PROTEIN

MENASSTTTSSTTTTTTGCSSVSSTSTSSSSTTEEVKPQKCLKRSQKGNNGNEQKKQNRNNDGGEHDPMYRGVRMRSWGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAALAIKGRSAYVNFPELAHLLPQPTTTSPKDIREAATKAAAATYGGDKAEPPTTSNQTTLSHSHSSTTLSSYNNWQDSSTSNQEDDTFFDLPDLALENADRSEAFQFYQSSWQLEAGADTGFRLETEEPFLWQIYQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026909`
TK1151 ID	TkA07G017350
OH-1004 ID	LXL04_026909
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 16.878 / OH-1004 16.194 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026909

Location Chr06:5165219-5165962 (-)

Description Similar to ERF034: Ethylene-responsive transcription factor ERF034

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g44940`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At3g60490`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At4g32800`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At5g11590`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At5g25810`	Putative transcriptional activator.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026909 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009825 multidimensional cell growth Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G44940

ath:AT3G60490

ath:AT4G32800

ath:AT5G11590

ath:AT5G25810

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.962

Rank 1 · LXL04_026909 · OH-1004

Cytoplasm0.090

Rank 2 · LXL04_026909 · OH-1004

Cell membrane0.033

Rank 3 · LXL04_026909 · OH-1004

Endoplasmic reticulum0.027

Rank 4 · LXL04_026909 · OH-1004

Plastid0.017

Rank 5 · LXL04_026909 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847.27AP269-118 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026909	`PF00847.27`	AP2	69	118	7.4e-15	55.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LBQ7`	Arabidopsis thaliana	Ethylene-responsive transcription factor ERF034	51.196%	Swiss-Prot	strong database homology
`Q9M210`	Arabidopsis thaliana	Ethylene-responsive transcription factor ERF035	49.321%	Swiss-Prot	moderate database homology
`Q9M080`	Arabidopsis thaliana	Ethylene-responsive transcription factor ERF043	68.269%	Swiss-Prot	weak database homology
`Q9LYD3`	Arabidopsis thaliana	Dehydration-responsive element-binding protein 3	68.224%	Swiss-Prot	weak database homology
`Q39127`	Arabidopsis thaliana	Ethylene-responsive transcription factor TINY	69.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card