LXL04_026618 | RubberDandelionOmics

Gene overview

LXL04_026618

Reference: OH-1004 Chr: Chr06 Coordinates: 90834-93205 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1077 bp · LXL04_026618|LXL04_026618|OH1004|cDNA

ATGGGGAAGAAAAGTGGATCCTCATGGCTCACCGCTGTTAAAAGGGCCTTCCGATCTCCTAGCAAAGATTCCGATAAAAAGACTCACAGAAGAAGTCATGATACTCAAGATCTCGAACTTGATGAGGAAGACGACAAGGTACCTTTTTTCCCGTTAATCCTTCATGTGTCGCTCTTGTATCACTTAAATGGATTTCTCCATGAAACGCAGAAAAGGGAAAAGAGAAGATGGCTGTTCCGGAAGCCCGCCAACGTGCAGGA...

CDS

Download CDS FASTA

1077 bp · LXL04_026618|LXL04_026618|OH1004|CDS

ATGGGGAAGAAAAGTGGATCCTCATGGCTCACCGCTGTTAAAAGGGCCTTCCGATCTCCTAGCAAAGATTCCGATAAAAAGACTCACAGAAGAAGTCATGATACTCAAGATCTCGAACTTGATGAGGAAGACGACAAGGTACCTTTTTTCCCGTTAATCCTTCATGTGTCGCTCTTGTATCACTTAAATGGATTTCTCCATGAAACGCAGAAAAGGGAAAAGAGAAGATGGCTGTTCCGGAAGCCCGCCAACGTGCAGGA...

Protein

Download Protein FASTA

358 aa · LXL04_026618|LXL04_026618|OH1004|PROTEIN

MGKKSGSSWLTAVKRAFRSPSKDSDKKTHRRSHDTQDLELDEEDDKVPFFPLILHVSLLYHLNGFLHETQKREKRRWLFRKPANVQDNATVQATQQAKMSNLSGGRIASDATCIESGASEQRHAIAVAVATVATAQAAMEVARLSRPPTSHSREHYAATIIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLQCMQALVRVQARVLDQRMKQSDQCTSRKSTFSDTNSAWGSRYHQDISDRKSMSRDGSSIA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026618`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026618

Location Chr06:90834-93205 (-)

Description Similar to IQD14: Protein IQ-DOMAIN 14

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g00820`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At1g01110`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At4g10640`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At3g49380`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At3g49260`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	Calcium channels activated by hydrogen peroxide mediate abscisic acid signalling in guard cells.2000 · DOI: 10.1038/35021067 A defined range of guard cell calcium oscillation parameters encodes stomatal movements.2001 · DOI: 10.1038/35082575 CO(2) signaling in guard cells: calcium sensitivity response modulation, a Ca(2+)-independent phase, and CO(2) insensitivity of the gca2 mutant.2006 · DOI: 10.1073/pnas.0602225103 Combinatorial interactions of multiple cis-elements regulating the induction of the Arabidopsis XERO2 dehydrin gene by abscisic acid and cold.2008 · DOI: 10.1111/j.1365-313x.2007.03399.x Calcium elevation-dependent and attenuated resting calcium-dependent abscisic acid induction of stomatal closure and abscisic acid-induced enhancement of calcium sensitivities of S-type anion and inward-rectifying K channels in Arabidopsis guard cells.2009 · DOI: 10.1111/j.1365-313x.2009.03872.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026618 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0019722 calcium-mediated signaling Biological Process

GO:0042542 response to hydrogen peroxide Biological Process

GO:0055074 calcium ion homeostasis Biological Process

GO:0071244 cellular response to carbon dioxide Biological Process

GO:0090333 regulation of stomatal closure Biological Process

GO:0005634 nucleus Cellular Component

GO:0005635 nuclear envelope Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G01110

ath:AT3G49260

ath:AT3G49380

ath:AT4G00820

ath:AT4G10640

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.461

Rank 1 · LXL04_026618 · OH-1004

Nucleus0.346

Rank 2 · LXL04_026618 · OH-1004

Cytoplasm0.341

Rank 3 · LXL04_026618 · OH-1004

Endoplasmic reticulum0.060

Rank 4 · LXL04_026618 · OH-1004

Plastid0.038

Rank 5 · LXL04_026618 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00612.34IQ157-175 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026618	`PF00612.34`	IQ	157	175	5.7e-07	29.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JHN2`	Arabidopsis thaliana	Protein IQ-DOMAIN 17	48.753%	Swiss-Prot	moderate database homology
`Q9MAM4`	Arabidopsis thaliana	Protein IQ-DOMAIN 18	47.709%	Swiss-Prot	moderate database homology
`Q7XA83`	Arabidopsis thaliana	Protein IQ-DOMAIN 16	35.185%	Swiss-Prot	moderate database homology
`Q9SG11`	Arabidopsis thaliana	Protein IQ-DOMAIN 15	41.441%	Swiss-Prot	moderate database homology
`Q9ASW3`	Arabidopsis thaliana	Protein IQ-DOMAIN 21	69.118%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card