LXL04_026604 | RubberDandelionOmics

Gene overview

LXL04_026604

Reference: OH-1004 Chr: Chr05 Coordinates: 129400224-129402039 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

675 bp · LXL04_026604|LXL04_026604|OH1004|cDNA

ATGATATCTATACCGCGGGCTGTTTTAAGTGTCGACGTCGAGATGAGAATGGCGTCAGGGAAAACATGGATGTCGATGTTTTGGCTATTGGCGATTGGCACGGTGTCGCAGGGAGCTGTGACTGGCGGTAGTCACCGGAACGCATACGCGACAATGATGTACATGGGGACGCCAAGGGACTATGAGTTCTACGTTGCTATTCGGGTGATGCTTAGATCTCTCTCGAAGCTCCGAGTAGATGCGGATCTGGTAGTCATTGC...

CDS

Download CDS FASTA

675 bp · LXL04_026604|LXL04_026604|OH1004|CDS

ATGATATCTATACCGCGGGCTGTTTTAAGTGTCGACGTCGAGATGAGAATGGCGTCAGGGAAAACATGGATGTCGATGTTTTGGCTATTGGCGATTGGCACGGTGTCGCAGGGAGCTGTGACTGGCGGTAGTCACCGGAACGCATACGCGACAATGATGTACATGGGGACGCCAAGGGACTATGAGTTCTACGTTGCTATTCGGGTGATGCTTAGATCTCTCTCGAAGCTCCGAGTAGATGCGGATCTGGTAGTCATTGC...

Protein

Download Protein FASTA

224 aa · LXL04_026604|LXL04_026604|OH1004|PROTEIN

MISIPRAVLSVDVEMRMASGKTWMSMFWLLAIGTVSQGAVTGGSHRNAYATMMYMGTPRDYEFYVAIRVMLRSLSKLRVDADLVVIASPDVPLRWIRTLEEDDGAKVVRVENLKNPYQNDTNHDRFKLTLNKLYAWSLVEYERVVMLDADNLFLQNTDELFQCGHFCAVFINPCIFHTGLFVVQKLDFQRRTIPSLICRRRLSNGLAMTQIAQRTADFRRYIPR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026604`
TK1151 ID	TkA06G000950
OH-1004 ID	LXL04_026604
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 88.038 / OH-1004 82.143 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026604

Location Chr05:129400224-129402039 (+)

Description Similar to PGSIP7: Putative glucuronosyltransferase PGSIP7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g16600`	Putative glucuronosyltransferase PGSIP7.	No verified direct reference in this release
`At2g35710`	Putative glucuronosyltransferase PGSIP8.	No verified direct reference in this release
`At5g18480`	Mediates the transfer of glucuronic acid (GlcA) from UDP-GlcA to glycosyl inositol phosphorylceramides (GIPCs).	Identification of a sphingolipid α-glucuronosyltransferase that is essential for pollen function in Arabidopsis.2014 · DOI: 10.1105/tpc.114.129171 Glycosylation of inositol phosphorylceramide sphingolipids is required for normal growth and reproduction in Arabidopsis.2017 · DOI: 10.1111/tpj.13382
`At1g77130`	May be involved in the substitutions of the xylan backbone in stem glucuronoxylan.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026604 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005978 glycogen biosynthetic process Biological Process

GO:0006673 inositol phosphoceramide metabolic process Biological Process

GO:0009555 pollen development Biological Process

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0045492 xylan biosynthetic process Biological Process

GO:0046513 ceramide biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0000138 Golgi trans cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G77130

ath:AT2G35710

ath:AT4G16600

ath:AT5G18480

hsa:8908

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.432

Rank 1 · LXL04_026604 · OH-1004

Endoplasmic reticulum0.246

Rank 2 · LXL04_026604 · OH-1004

Extracellular0.176

Rank 3 · LXL04_026604 · OH-1004

Cytoplasm0.121

Rank 4 · LXL04_026604 · OH-1004

Cell membrane0.068

Rank 5 · LXL04_026604 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11051.15Mannosyl_trans3106-163 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026604	`PF11051.15`	Mannosyl_trans3	106	163	7.9e-06	26.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JMI5`	Arabidopsis thaliana	Putative glucuronosyltransferase PGSIP7	79.577%	Swiss-Prot	moderate database homology
`Q8VZP6`	Arabidopsis thaliana	Putative glucuronosyltransferase PGSIP8	79.433%	Swiss-Prot	moderate database homology
`Q8GWB7`	Arabidopsis thaliana	Inositol phosphorylceramide glucuronosyltransferase 1	30.435%	Swiss-Prot	moderate database homology
`Q8W4A7`	Arabidopsis thaliana	Putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 3	26.667%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card