LXL04_026499 | RubberDandelionOmics

Gene overview

LXL04_026499

Reference: OH-1004 Chr: Chr05 Coordinates: 127409020-127414195 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2478 bp · LXL04_026499|LXL04_026499|OH1004|cDNA

ATGGCCGACTCTCAGCAGGTCCGATCCACCACCGACACCAGTAACAACCTCCCTGTTGCAATCGTCCATTGCCTCCCCAGCTACAAGTTCTCCCTCGCGTGGACTAAAGAAATCGTCAACACAATCGAACCTTCAGATCCCTTATATCCAATCCACAGTCCATCTGCTCGGGCCGTGATCGTCATCGGTCTTACCCCGCTCAAATCGGAGCATTTGGACCAGTATCCATCCGTTGAATGCGTTTTTGGAACATCCGCCGG...

CDS

Download CDS FASTA

2478 bp · LXL04_026499|LXL04_026499|OH1004|CDS

ATGGCCGACTCTCAGCAGGTCCGATCCACCACCGACACCAGTAACAACCTCCCTGTTGCAATCGTCCATTGCCTCCCCAGCTACAAGTTCTCCCTCGCGTGGACTAAAGAAATCGTCAACACAATCGAACCTTCAGATCCCTTATATCCAATCCACAGTCCATCTGCTCGGGCCGTGATCGTCATCGGTCTTACCCCGCTCAAATCGGAGCATTTGGACCAGTATCCATCCGTTGAATGCGTTTTTGGAACATCCGCCGG...

Protein

Download Protein FASTA

825 aa · LXL04_026499|LXL04_026499|OH1004|PROTEIN

MADSQQVRSTTDTSNNLPVAIVHCLPSYKFSLAWTKEIVNTIEPSDPLYPIHSPSARAVIVIGLTPLKSEHLDQYPSVECVFGTSAGVDHIDLVECRRRNIRVASAGDAFSEDVADYAIGLLIDVLRQVSASDRYVRSGLWPVKGDYPLGNKVGGKRVGIVGLGRIGTLVAKRLEPFGCTIGYTSRTKKPQVPYQFHSTVLDLATNSDALILCCSFTEKTRHVIDHDVMKALGKRGIIVNIGRGALMDEKELVKLLTDGE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026499`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026499

Location Chr05:127409020-127414195 (-)

Description Similar to EXPA7: Expansin-A7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g12560`	Causes loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release
`At1g12550`	Catalyzes the NADPH-dependent reduction of glyoxylate and hydroxypyruvate (HP) into glycolate and glycerate.	The hydroxypyruvate-reducing system in Arabidopsis: multiple enzymes for the same end.2011 · DOI: 10.1104/pp.110.166538
`At1g62980`	Causes loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0535900`	May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026499 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009826 unidimensional cell growth Biological Process

GO:0009828 plant-type cell wall loosening Biological Process

GO:0009853 photorespiration Biological Process

GO:0009854 oxidative photosynthetic carbon pathway Biological Process

GO:0048767 root hair elongation Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0016618 hydroxypyruvate reductase [NAD(P)H] activity Molecular Function

GO:0030267 glyoxylate reductase (NADPH) activity Molecular Function

GO:0051287 NAD binding Molecular Function

GO:0120509 hydroxypyruvate reductase (NADPH) activity Molecular Function

KEGG gene cross-reference

ath:AT1G12550

ath:AT1G12560

ath:AT1G62980

osa:107277540

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.484

Rank 1 · LXL04_026499 · OH-1004

Extracellular0.182

Rank 2 · LXL04_026499 · OH-1004

Lysosome / Vacuole0.134

Rank 3 · LXL04_026499 · OH-1004

Nucleus0.109

Rank 4 · LXL04_026499 · OH-1004

Endoplasmic reticulum0.082

Rank 5 · LXL04_026499 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00389.372-Hacid_dh55-232 aa

PF02826.262-Hacid_dh_C119-292 aa

PF00389.372-Hacid_dh375-547 aa

PF02826.262-Hacid_dh_C434-607 aa

PF29515.1Expansin_N618-708 aa

PF03330.25DPBB_1636-720 aa

PF01357.28Expansin_C732-809 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026499	`PF00389.37`	2-Hacid_dh	55	232	5.2e-27	94.9
LXL04_026499	`PF02826.26`	2-Hacid_dh_C	119	292	5.9e-98	326.1
LXL04_026499	`PF00389.37`	2-Hacid_dh	375	547	5.2e-27	94.9
LXL04_026499	`PF02826.26`	2-Hacid_dh_C	434	607	5.9e-98	326.1
LXL04_026499	`PF29515.1`	Expansin_N	618	708	2.6e-09	38.0
LXL04_026499	`PF03330.25`	DPBB_1	636	720	2.6e-20	73.2
LXL04_026499	`PF01357.28`	Expansin_C	732	809	5.1e-25	88.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LN94`	Arabidopsis thaliana	Expansin-A7	67.421%	Swiss-Prot	weak database homology
`Q9LE33`	Arabidopsis thaliana	Glyoxylate/hydroxypyruvate reductase HPR3	54.325%	Swiss-Prot	weak database homology
`Q9LQ07`	Arabidopsis thaliana	Expansin-A18	68.075%	Swiss-Prot	weak database homology
`Q8W2X8`	Oryza sativa subsp. japonica	Putative expansin-A30	63.556%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card