LXL04_026465 | RubberDandelionOmics

Gene overview

LXL04_026465

Reference: OH-1004 Chr: Chr05 Coordinates: 126737983-126739106 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

894 bp · LXL04_026465|LXL04_026465|OH1004|cDNA

ATGGAGGAGAAAAGAACTGCACTTGTCACCGGAGGAAACACAGGAATTGGATTTGAGACGTGTCGTCAATTGGCTTCAAATGGAATTAGAGTCATATTAACAGATAGAGACGAAAACCTGGGGGGTAAAGTAGTTCAGCAACTCAATCTATCCGGCTTCCCCGACGTCGTTTTTCATCAACTCGATATCACAAATCGAACCAGCATCTCACGTACAGTCGATTTCGTGAAATCCCACTTCAAAAAGCTCGATATATTGGT...

CDS

Download CDS FASTA

894 bp · LXL04_026465|LXL04_026465|OH1004|CDS

ATGGAGGAGAAAAGAACTGCACTTGTCACCGGAGGAAACACAGGAATTGGATTTGAGACGTGTCGTCAATTGGCTTCAAATGGAATTAGAGTCATATTAACAGATAGAGACGAAAACCTGGGGGGTAAAGTAGTTCAGCAACTCAATCTATCCGGCTTCCCCGACGTCGTTTTTCATCAACTCGATATCACAAATCGAACCAGCATCTCACGTACAGTCGATTTCGTGAAATCCCACTTCAAAAAGCTCGATATATTGGT...

Protein

Download Protein FASTA

297 aa · LXL04_026465|LXL04_026465|OH1004|PROTEIN

MEEKRTALVTGGNTGIGFETCRQLASNGIRVILTDRDENLGGKVVQQLNLSGFPDVVFHQLDITNRTSISRTVDFVKSHFKKLDILVNNAGHMGIVIVNEEKFKAGEGFVQVLDEKAHLLTDILKQSYELAEECIKTNYYGTKAVTMAFLPLLQLSDSPRIVNITSRYGELFFIHNEKVRNELRDMKTVTEERLDEITSRFLSDMKAGKLEENGWPLTVSAYKVSKAAINAYTRLMAKEYPKMLINSVHPGYVITDMSVQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026465`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026465

Location Chr05:126737983-126739106 (+)

Description Similar to SDR1: (+)-neomenthol dehydrogenase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g61220`	Aldehyde reductase that catalyzes the reduction of the aldehyde carbonyl groups on saturated and alpha,beta-unsaturated aldehydes with more than 5 carbons.	No verified direct reference in this release
`At2g24190`	Aldehyde reductase that catalyzes the reduction of the aldehyde carbonyl groups on saturated and alpha,beta-unsaturated aldehydes with more than 5 carbons.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026465 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009820 alkaloid metabolic process Biological Process

GO:0016104 triterpenoid biosynthetic process Biological Process

GO:0016135 saponin biosynthetic process Biological Process

GO:0097295 morphine biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0008106 alcohol dehydrogenase (NADP+) activity Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Molecular Function

KEGG gene cross-reference

ag:ABC47654

ath:AT2G24190

ath:AT3G61220

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.699

Rank 1 · LXL04_026465 · OH-1004

Nucleus0.229

Rank 2 · LXL04_026465 · OH-1004

Mitochondrion0.107

Rank 3 · LXL04_026465 · OH-1004

Peroxisome0.099

Rank 4 · LXL04_026465 · OH-1004

Endoplasmic reticulum0.059

Rank 5 · LXL04_026465 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00106.32adh_short6-171 aa

PF08659.17KR6-100 aa

PF01370.28Epimerase7-76 aa

PF13561.13adh_short_C214-94 aa

PF13561.13adh_short_C2218-260 aa

PF00106.32adh_short219-260 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026465	`PF00106.32`	adh_short	6	171	4.6e-36	124.8
LXL04_026465	`PF08659.17`	KR	6	100	9.8e-08	32.8
LXL04_026465	`PF01370.28`	Epimerase	7	76	3.4e-07	30.6
LXL04_026465	`PF13561.13`	adh_short_C2	14	94	1.6e-25	90.8
LXL04_026465	`PF13561.13`	adh_short_C2	218	260	1.6e-25	90.8
LXL04_026465	`PF00106.32`	adh_short	219	260	4.6e-36	124.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M2E2`	Arabidopsis thaliana	(+)-neomenthol dehydrogenase	48.495%	Swiss-Prot	moderate database homology
`Q9ZUH5`	Arabidopsis thaliana	Short-chain dehydrogenase/reductase 2b	47.492%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card