LXL04_026124 | RubberDandelionOmics

Gene overview

LXL04_026124

Reference: OH-1004 Chr: Chr05 Coordinates: 121267082-121269815 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2577 bp · LXL04_026124|LXL04_026124|OH1004|cDNA

ATGATGTCAAGATCTTACACTAATCTCTTCGAACTAGCATCCGGTGAAACCCCATTACCATCATCCGGTTTTGGGCGCCACATAGGAAAGAAACTTTCCCGTGTGGCAACCGTACCGGGGATACTATCGGAACTGGACGAAGAAGGGTTCAGTTCCGATGTCCCATCATCCGTTTCACAGGAACGGATGATCCTGGTCGGGAACCAGCTCCCGCTTCGGGTCCAGTCTGGACCCGATGGGAGCTGGACATTCAGTTGGGA...

CDS

Download CDS FASTA

2577 bp · LXL04_026124|LXL04_026124|OH1004|CDS

ATGATGTCAAGATCTTACACTAATCTCTTCGAACTAGCATCCGGTGAAACCCCATTACCATCATCCGGTTTTGGGCGCCACATAGGAAAGAAACTTTCCCGTGTGGCAACCGTACCGGGGATACTATCGGAACTGGACGAAGAAGGGTTCAGTTCCGATGTCCCATCATCCGTTTCACAGGAACGGATGATCCTGGTCGGGAACCAGCTCCCGCTTCGGGTCCAGTCTGGACCCGATGGGAGCTGGACATTCAGTTGGGA...

Protein

Download Protein FASTA

858 aa · LXL04_026124|LXL04_026124|OH1004|PROTEIN

MMSRSYTNLFELASGETPLPSSGFGRHIGKKLSRVATVPGILSELDEEGFSSDVPSSVSQERMILVGNQLPLRVQSGPDGSWTFSWDEDSLLLQLKDGLNEDVEIIYVGCLREQIDPKDQDDVAQHLLENFKCVPAFIPPELFTKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRSLWQAYVSVNKIFADKVMEVISPDDDFVWVHDYHLMVLPTFLRKRFNRVKLGFFLHSPFPSSEIYRTLPVRDELLRALLNSDLIG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026124`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026124

Location Chr05:121267082-121269815 (+)

Description Similar to TPS5: Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g17770`	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5.	No verified direct reference in this release
`At1g68020`	Regulates plant architecture, shape of epidermal pavement cells and branching of trichomes.	Trehalose-6-phosphate synthase/phosphatase regulates cell shape and plant architecture in Arabidopsis.2008 · DOI: 10.1104/pp.107.107441
`At1g06410`	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 7.	No verified direct reference in this release
`At1g23870`	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9.	No verified direct reference in this release
`At1g60140`	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 10.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026124 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005992 trehalose biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003825 alpha,alpha-trehalose-phosphate synthase (UDP-forming) activity Molecular Function

GO:0004805 trehalose-phosphatase activity Molecular Function

GO:0016757 glycosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G06410

ath:AT1G23870

ath:AT1G60140

ath:AT1G68020

ath:AT4G17770

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.429

Rank 1 · LXL04_026124 · OH-1004

Nucleus0.281

Rank 2 · LXL04_026124 · OH-1004

Cell membrane0.208

Rank 3 · LXL04_026124 · OH-1004

Golgi apparatus0.103

Rank 4 · LXL04_026124 · OH-1004

Lysosome / Vacuole0.093

Rank 5 · LXL04_026124 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00982.28Glyco_transf_2062-546 aa

PF02358.23Trehalose_PPase596-830 aa

PF08282.19Hydrolase_3724-801 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026124	`PF00982.28`	Glyco_transf_20	62	546	1.2e-185	618.5
LXL04_026124	`PF02358.23`	Trehalose_PPase	596	830	7.5e-81	271.4
LXL04_026124	`PF08282.19`	Hydrolase_3	724	801	6.4e-06	26.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23617`	Arabidopsis thaliana	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5	77.294%	Swiss-Prot	strong database homology
`Q94AH8`	Arabidopsis thaliana	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6	71.065%	Swiss-Prot	strong database homology
`Q9LMI0`	Arabidopsis thaliana	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 7	65.217%	Swiss-Prot	strong database homology
`Q9LRA7`	Arabidopsis thaliana	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9	62.397%	Swiss-Prot	strong database homology
`O80738`	Arabidopsis thaliana	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 10	61.131%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card