Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1179 bp · LXL04_025700|LXL04_025700|OH1004|cDNA
ATGGGGACGACGGCGGCGATTGGCGTGACTGAGATAGAAGGAAGGGGGAGGGCAATGGTGGCCCTCCGCCCATTAAAAGGAGGTGAAATCGTTCTCAAGGACTCCCCTATAGTTCTTTACTCTGCTCTTCCTTTTCAGTCAAATAATCACCAGAACAACAATGGCTACTGCTCCAATTGCTTCACTAGCATCACAAAACAGCCTCAAAACGTCTCTTGTTCCACCTGCGGATCCCGATTCTGTACCTTCGAATGCCAATC...
1179 bp · LXL04_025700|LXL04_025700|OH1004|CDS
ATGGGGACGACGGCGGCGATTGGCGTGACTGAGATAGAAGGAAGGGGGAGGGCAATGGTGGCCCTCCGCCCATTAAAAGGAGGTGAAATCGTTCTCAAGGACTCCCCTATAGTTCTTTACTCTGCTCTTCCTTTTCAGTCAAATAATCACCAGAACAACAATGGCTACTGCTCCAATTGCTTCACTAGCATCACAAAACAGCCTCAAAACGTCTCTTGTTCCACCTGCGGATCCCGATTCTGTACCTTCGAATGCCAATC...
Protein
Download Protein FASTA392 aa · LXL04_025700|LXL04_025700|OH1004|PROTEIN
MGTTAAIGVTEIEGRGRAMVALRPLKGGEIVLKDSPIVLYSALPFQSNNHQNNNGYCSNCFTSITKQPQNVSCSTCGSRFCTFECQSAASSTSHTPWVCQALIRLRQYFSDHHQALDLQLQARFLVSAYNLAFVSPPRFHTLLSLQGSVHTHPDADSSANFLHSLISSICPPPQLELGFTLELTSVLLAKDKLNAFGLMEPFSEEREERTVRAYGVYPVASFFNHDCLPNACRFDYIDVAGSASGNNTDITIRMIHDVPQ...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_025700 |
|---|---|
| TK1151 ID | TkAUNG020170 |
| OH-1004 ID | LXL04_025700 |
| Relationship / confidence | Rbh Sequence Supported / Probable |
| Protein identity (%) | 93.600 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 95.408Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_025700 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr05:115500076-115501254 (+) | |||||||||
| Description | Similar to ASHR2: Histone-lysine N-methyltransferase ASHR2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006334 nucleosome assembly Biological Process GO:0006469 negative regulation of protein kinase activity Biological Process GO:0032259 methylation Biological Process GO:0033138 positive regulation of peptidyl-serine phosphorylation Biological Process GO:0045184 establishment of protein localization Biological Process GO:0045892 negative regulation of DNA-templated transcription Biological Process GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process GO:0071549 cellular response to dexamethasone stimulus Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005694 chromosome Cellular Component GO:0005737 cytoplasm Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT2G19640 hsa:64754 mmu:69726 sce:YPL165C These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00856.34SET16-268 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_025700 | PF00856.34 | SET | 16 | 268 | 4e-08 | 34.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.