LXL04_025088 | RubberDandelionOmics

Gene overview

LXL04_025088

Reference: OH-1004 Chr: Chr05 Coordinates: 105771009-105773414 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2235 bp · LXL04_025088|LXL04_025088|OH1004|cDNA

ATGTGTACACCTTTCCGGTCTCCAAGCCTTCTCTTTACTTCTTTCCGCTTTGCTTTTTTaattcctctctctctctctctcacagTACTCACAGAAAACAGAGTAGCGACATCCATGGCTGCCAACAAATTTGCAACGATGGTGCACACGAATACAAACAACATCACACTCATTCTCGTGTATGCTGTTCTTGAATGGACACTCATACTTCTTCTCCTTCTCAACTCCCTCTTCTCTTTTCTCATCATCAAATTTTCCCA...

CDS

Download CDS FASTA

2235 bp · LXL04_025088|LXL04_025088|OH1004|CDS

ATGTGTACACCTTTCCGGTCTCCAAGCCTTCTCTTTACTTCTTTCCGCTTTGCTTTTTTAATTCCTCTCTCTCTCTCTCTCACAGTACTCACAGAAAACAGAGTAGCGACATCCATGGCTGCCAACAAATTTGCAACGATGGTGCACACGAATACAAACAACATCACACTCATTCTCGTGTATGCTGTTCTTGAATGGACACTCATACTTCTTCTCCTTCTCAACTCCCTCTTCTCTTTTCTCATCATCAAATTTTCCCA...

Protein

Download Protein FASTA

744 aa · LXL04_025088|LXL04_025088|OH1004|PROTEIN

MCTPFRSPSLLFTSFRFAFLIPLSLSLTVLTENRVATSMAANKFATMVHTNTNNITLILVYAVLEWTLILLLLLNSLFSFLIIKFSQLFALKPPCLWCSTLHRFLEPENINSHRDLLCELHSKEVSILGFCPNHKKVAEIDELCEDCFSSHLDFQSEVKQSDGEDEDEQYLECSCCGLKFQRKKCVDSFIVTRNSCDVLENSKSEGLITGLNDRLGSDVMGENLKIESRKETRMNHEGKDVWVSNTIENETDMDQFEKKK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025088`
TK1151 ID	TkA06G081210
OH-1004 ID	LXL04_025088
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.100
Protein coverage (%)	TK1151 92.197 / OH-1004 60.887 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025088

Location Chr05:105771009-105773414 (+)

Description Similar to MYOB2: Myosin-binding protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g70750`	Membrane-anchored myosin receptors that define a distinct, plant-specific transport vesicle compartment.	No verified direct reference in this release
`At5g16720`	Membrane-anchored myosin receptors that define a distinct, plant-specific transport vesicle compartment.	No verified direct reference in this release
`At1g08800`	Membrane-anchored myosin receptors that define a distinct, plant-specific transport vesicle compartment.	Identification of myosin XI receptors in Arabidopsis defines a distinct class of transport vesicles.2013 · DOI: 10.1105/tpc.113.113704
`At1g74830`	Probable membrane-anchored myosin receptors.	No verified direct reference in this release
`At2g30690`	Membrane-anchored myosin receptors that define a distinct, plant-specific transport vesicle compartment.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025088 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005737 cytoplasm Cellular Component

GO:0005811 lipid droplet Cellular Component

GO:0016020 membrane Cellular Component

GO:0030133 transport vesicle Cellular Component

GO:0017022 myosin binding Molecular Function

GO:0080115 myosin XI tail binding Molecular Function

KEGG gene cross-reference

ath:AT1G08800

ath:AT1G70750

ath:AT5G16720

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.407

Rank 1 · LXL04_025088 · OH-1004

Nucleus0.319

Rank 2 · LXL04_025088 · OH-1004

Cell membrane0.225

Rank 3 · LXL04_025088 · OH-1004

Endoplasmic reticulum0.130

Rank 4 · LXL04_025088 · OH-1004

Golgi apparatus0.117

Rank 5 · LXL04_025088 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04576.21Zein-binding460-545 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025088	`PF04576.21`	Zein-binding	460	545	1.5e-30	106.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9CAC4`	Arabidopsis thaliana	Myosin-binding protein 2	36.688%	Swiss-Prot	moderate database homology
`Q0WNW4`	Arabidopsis thaliana	Myosin-binding protein 3	44.481%	Swiss-Prot	weak database homology
`F4HXQ7`	Arabidopsis thaliana	Myosin-binding protein 1	31.690%	Swiss-Prot	weak database homology
`F4HVS6`	Arabidopsis thaliana	Probable myosin-binding protein 6	51.613%	Swiss-Prot	weak database homology
`F4INW9`	Arabidopsis thaliana	Probable myosin-binding protein 4	50.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card