RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_024508
Reference: OH-1004 Chr: Chr05 Coordinates: 92385886-92386790 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

588 bp · LXL04_024508|LXL04_024508|OH1004|cDNA

TGATCCGTCAACATGTATACATCAAGGAAGAAGATTCAGAAGGACAAGGATGTCGAGCCCACTGAATTCGAGGAGTCTGTTGCTCAGGCATTGTTTGATCTGGAGAACGCAAACCAAGACCTCAAGAGTGACTTGAAGGACCTCTACATCAACAGTGCCACCCAAATTGATGTATCTGGAAACCGCAAAGCTGTAGTGATTCATGTTCCTTACAGATTAAGGAAAGGCTTCCGCAAGATTCACCTCAAGCTTGTGAGGGA...

CDS

Download CDS FASTA

576 bp · LXL04_024508|LXL04_024508|OH1004|CDS

ATGTATACATCAAGGAAGAAGATTCAGAAGGACAAGGATGTCGAGCCCACTGAATTCGAGGAGTCTGTTGCTCAGGCATTGTTTGATCTGGAGAACGCAAACCAAGACCTCAAGAGTGACTTGAAGGACCTCTACATCAACAGTGCCACCCAAATTGATGTATCTGGAAACCGCAAAGCTGTAGTGATTCATGTTCCTTACAGATTAAGGAAAGGCTTCCGCAAGATTCACCTCAAGCTTGTGAGGGAACTTGAGAAGAA...

Protein

Download Protein FASTA

191 aa · LXL04_024508|LXL04_024508|OH1004|PROTEIN

MYTSRKKIQKDKDVEPTEFEESVAQALFDLENANQDLKSDLKDLYINSATQIDVSGNRKAVVIHVPYRLRKGFRKIHLKLVRELEKKFSGKDVVLIATRRMVPPPKKGSAAQRPRSRTLTAVHDAMLEDIVHPAEIVGKRIRYRIDGTKIIKIYLDPKARNDTEYKLETFTGVYRKLCGKDVVFEYPITEA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_024508
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_024508
LocationChr05:92385886-92386790 (+)
DescriptionSimilar to RPS7: 40S ribosomal protein S7
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g02560 Small ribosomal subunit protein eS7y. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os05g0346300 Small ribosomal subunit protein eS7. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_024508 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0006364 rRNA processing Biological Process
GO:0006412 translation Biological Process
GO:0042274 ribosomal small subunit biogenesis Biological Process
GO:0005829 cytosol Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0022626 cytosolic ribosome Cellular Component
GO:0022627 cytosolic small ribosomal subunit Cellular Component
GO:0030686 90S preribosome Cellular Component
GO:0032040 small-subunit processome Cellular Component
GO:0003729 mRNA binding Molecular Function
GO:0003735 structural constituent of ribosome Molecular Function
KEGG gene cross-reference
ath:AT3G02560
dosa:Os05g0346300
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.706
Rank 1 · LXL04_024508 · OH-1004
Nucleus0.371
Rank 2 · LXL04_024508 · OH-1004
Endoplasmic reticulum0.064
Rank 3 · LXL04_024508 · OH-1004
Mitochondrion0.033
Rank 4 · LXL04_024508 · OH-1004
Cell membrane0.022
Rank 5 · LXL04_024508 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01251.24Ribosomal_S7e7-186 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_024508PF01251.24Ribosomal_S7e71869.9e-79264.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9M885Arabidopsis thalianaSmall ribosomal subunit protein eS7y75.916%Swiss-Protstrong database homology
Q8LJU5Oryza sativa subsp. japonicaSmall ribosomal subunit protein eS775.916%Swiss-Protstrong database homology

JBrowse

View in Genome Browser