LXL04_024442 | RubberDandelionOmics

Gene overview

LXL04_024442

Reference: OH-1004 Chr: Chr05 Coordinates: 90763078-90765754 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1764 bp · LXL04_024442|LXL04_024442|OH1004|cDNA

ATGAGACTCGTTCTTCACTGCAACAATATCGTTCATCTGTCTGACAATAATATCGAATCGGTTGCGAAACTATACAAAGATAAGGTGCAAAAACTAGAGATGAGGAAAGAATTGGTAGTTGGAGCGTCTGTGGCGACGGTGGCTACCTTGGTGGCGGCTGGAGTGCTGATGGTTCGTTGGAAGAAACGAGATGAGAGACGATGGAGACAGACGCAACGGATACTACGTAGATTCGCTAGGGACTGTGCTACTCCGGTGCC...

CDS

Download CDS FASTA

1764 bp · LXL04_024442|LXL04_024442|OH1004|CDS

ATGAGACTCGTTCTTCACTGCAACAATATCGTTCATCTGTCTGACAATAATATCGAATCGGTTGCGAAACTATACAAAGATAAGGTGCAAAAACTAGAGATGAGGAAAGAATTGGTAGTTGGAGCGTCTGTGGCGACGGTGGCTACCTTGGTGGCGGCTGGAGTGCTGATGGTTCGTTGGAAGAAACGAGATGAGAGACGATGGAGACAGACGCAACGGATACTACGTAGATTCGCTAGGGACTGTGCTACTCCGGTGCC...

Protein

Download Protein FASTA

587 aa · LXL04_024442|LXL04_024442|OH1004|PROTEIN

MRLVLHCNNIVHLSDNNIESVAKLYKDKVQKLEMRKELVVGASVATVATLVAAGVLMVRWKKRDERRWRQTQRILRRFARDCATPVPKLWHVAFDLVSDMQTSLSDQSQTDFVMLPSYTSSLPNGNEEGLYYGVNLREDNFLLLSARLRGKHESITDLQREEVDIPAEVISGGLKELFDFIALKLAVFISTKTKTDPIAPKGKLGFTVSFPLLEGPAAATHKNVIRWKSFSVNDAVGKELAHEVNEALGKHGIDLRVSAL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024442`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024442

Location Chr05:90763078-90765754 (-)

Description Similar to At4g37840: Probable hexokinase-like 2 protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g37840`	Fructose and glucose phosphorylating enzyme.	No verified direct reference in this release
`At4g29130`	Fructose and glucose phosphorylating enzyme.	Role of the Arabidopsis glucose sensor HXK1 in nutrient, light, and hormonal signaling.2003 · DOI: 10.1126/science.1080585 Mitochondria-associated hexokinases play a role in the control of programmed cell death in Nicotiana benthamiana.2006 · DOI: 10.1105/tpc.106.041509 Cooperative control between AtRGS1 and AtHXK1 in a WD40-repeat protein pathway in Arabidopsis thaliana.2015 · DOI: 10.3389/fpls.2015.00851 Sugar and hexokinase suppress expression of PIP aquaporins and reduce leaf hydraulics that preserves leaf water potential.2017 · DOI: 10.1111/tpj.13568 The role of HEXOKINASE1 in Arabidopsis leaf growth.2019 · DOI: 10.1007/s11103-018-0803-0 Guard cells control hypocotyl elongation through HXK1, HY5, and PIF4.2021 · DOI: 10.1038/s42003-021-02283-y HEXOKINASE1 forms a nuclear complex with the PRC2 subunits CURLY LEAF and SWINGER to regulate glucose signaling.2022 · DOI: 10.1111/jipb.13261

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0722700`	Fructose and glucose phosphorylating enzyme.	Structure, expression, and functional analysis of the hexokinase gene family in rice (Oryza sativa L.).2006 · DOI: 10.1007/s00425-006-0251-y

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024442 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001678 intracellular glucose homeostasis Biological Process

GO:0006006 glucose metabolic process Biological Process

GO:0006096 glycolytic process Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0006974 DNA damage response Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009408 response to heat Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009749 response to glucose Biological Process

KEGG gene cross-reference

ath:AT4G29130

ath:AT4G37840

nta:107797523

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.364

Rank 1 · LXL04_024442 · OH-1004

Mitochondrion0.230

Rank 2 · LXL04_024442 · OH-1004

Nucleus0.210

Rank 3 · LXL04_024442 · OH-1004

Endoplasmic reticulum0.139

Rank 4 · LXL04_024442 · OH-1004

Cell membrane0.112

Rank 5 · LXL04_024442 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00349.28Hexokinase_175-273 aa

PF03727.23Hexokinase_2280-513 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024442	`PF00349.28`	Hexokinase_1	75	273	4.1e-38	131.9
LXL04_024442	`PF03727.23`	Hexokinase_2	280	513	1.3e-64	218.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9T071`	Arabidopsis thaliana	Probable hexokinase-like 2 protein	55.556%	Swiss-Prot	strong database homology
`Q42525`	Arabidopsis thaliana	Hexokinase-1	45.992%	Swiss-Prot	moderate database homology
`Q2KNB7`	Oryza sativa subsp. japonica	Hexokinase-9	42.857%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card