LXL04_023790 | RubberDandelionOmics

Gene overview

LXL04_023790

Reference: OH-1004 Chr: Chr05 Coordinates: 68492068-68493684 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

945 bp · LXL04_023790|LXL04_023790|OH1004|cDNA

ATGACGAGCTTTTTGATTCCCCCGTGTCGACCACTCGTCAAACTGCCAAGACTCGCGTCATCTAATCCCTACAGGCAAATCATTTCTCTTACTGAGGTTAGTTCCAAATTGTTTCAGTTATTCGCATCGATCCAATTCATCTTTGTTTTATCAGTGTCGTGGTCAAGAAGAATCGAGCATTTGAGGTCTCATGCGACCACTCCTGTTTCGAAAAGATGCACATTCATTGATCGAACAGCCACTTCTCCTTTCAAATTGCT...

CDS

Download CDS FASTA

945 bp · LXL04_023790|LXL04_023790|OH1004|CDS

ATGACGAGCTTTTTGATTCCCCCGTGTCGACCACTCGTCAAACTGCCAAGACTCGCGTCATCTAATCCCTACAGGCAAATCATTTCTCTTACTGAGGTTAGTTCCAAATTGTTTCAGTTATTCGCATCGATCCAATTCATCTTTGTTTTATCAGTGTCGTGGTCAAGAAGAATCGAGCATTTGAGGTCTCATGCGACCACTCCTGTTTCGAAAAGATGCACATTCATTGATCGAACAGCCACTTCTCCTTTCAAATTGCT...

Protein

Download Protein FASTA

314 aa · LXL04_023790|LXL04_023790|OH1004|PROTEIN

MTSFLIPPCRPLVKLPRLASSNPYRQIISLTEVSSKLFQLFASIQFIFVLSVSWSRRIEHLRSHATTPVSKRCTFIDRTATSPFKLLDIRDIKYRPPGTQINLLNDVTLTLPKKSFGMIFGRSGSGKTTLLQLIAGLTKPTSGSIYIQGYSDEGTPNQPPVLLSPERVGIVFQFPERYFVADNVFDEITFGLPRQKTDLTTKQLIATRLERAITSVGLNGISLDKNPNSLSGGYKRRLALAIQLVQIPELLVLDEPLAGL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_023790`
TK1151 ID	TkA06G218640
OH-1004 ID	LXL04_023790
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	93.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_023790

Location Chr05:68492068-68493684 (+)

Description Similar to ABCI11: ABC transporter I family member 11, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g14100`	ABC transporter I family member 11, chloroplastic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023790 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009658 chloroplast organization Biological Process

GO:0060586 multicellular organismal-level iron ion homeostasis Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009706 chloroplast inner membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0043190 ATP-binding cassette (ABC) transporter complex Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0032217 riboflavin transmembrane transporter activity Molecular Function

GO:0042626 ATPase-coupled transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT5G14100

cac:CA_C3101

cth:Cthe_2936

sag:SAG2150

sth:STH3044

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.952

Rank 1 · LXL04_023790 · OH-1004

Mitochondrion0.074

Rank 2 · LXL04_023790 · OH-1004

Cytoplasm0.023

Rank 3 · LXL04_023790 · OH-1004

Nucleus0.016

Rank 4 · LXL04_023790 · OH-1004

Peroxisome0.011

Rank 5 · LXL04_023790 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00005.34ABC_tran104-258 aa

PF13304.13AAA_21227-290 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_023790	`PF00005.34`	ABC_tran	104	258	3.3e-24	86.7
LXL04_023790	`PF13304.13`	AAA_21	227	290	8.5e-09	36.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LEF6`	Arabidopsis thaliana	ABC transporter I family member 11, chloroplastic	66.802%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card