Gene Card
Gene overview
cDNA / CDS / Protein Sequences
429 bp · LXL04_023609|LXL04_023609|OH1004|cDNA
ATGCTTTTCAAATGGAAGTTTACTGGTGATGTCGTAACAAGATTGATTACAGAACCTCGGCGTTTGGTGCCTGATGTATCTGTCGATCACGGAATTTTTACACTCTTGGCTGTACCAATTGATAGGATGTCAATGGCTGTTGCTGAGTGTTTTTCTGTCTTAAAACCCGGTGGATTAGATTTCTTCAAGGACCATGGACTTTATGACATGACAATGCTGCGATTTGAAGCTGATCAAAGAGTGGGATTTAGGGAATACAA...
429 bp · LXL04_023609|LXL04_023609|OH1004|CDS
ATGCTTTTCAAATGGAAGTTTACTGGTGATGTCGTAACAAGATTGATTACAGAACCTCGGCGTTTGGTGCCTGATGTATCTGTCGATCACGGAATTTTTACACTCTTGGCTGTACCAATTGATAGGATGTCAATGGCTGTTGCTGAGTGTTTTTCTGTCTTAAAACCCGGTGGATTAGATTTCTTCAAGGACCATGGACTTTATGACATGACAATGCTGCGATTTGAAGCTGATCAAAGAGTGGGATTTAGGGAATACAA...
Protein
Download Protein FASTA142 aa · LXL04_023609|LXL04_023609|OH1004|PROTEIN
MLFKWKFTGDVVTRLITEPRRLVPDVSVDHGIFTLLAVPIDRMSMAVAECFSVLKPGGLDFFKDHGLYDMTMLRFEADQRVGFREYKRSDGTRSYFFSLDSTRVTPGNFSSFTIHKPAVLLFISQQYCSSQLFNGRNIIKSQ
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_023609 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_023609 |
|---|---|
| Location | Chr05:55179933-55181058 (+) |
| Description | Similar to METTL6: tRNA N(3)-methylcytidine methyltransferase METTL6 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006400 tRNA modification Biological Process GO:0030488 tRNA methylation Biological Process GO:0032259 methylation Biological Process GO:0106217 tRNA C3-cytosine methylation Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0043527 tRNA methyltransferase complex Cellular Component GO:0008173 RNA methyltransferase activity Molecular Function GO:0008757 S-adenosylmethionine-dependent methyltransferase activity Molecular Function GO:0019899 enzyme binding Molecular Function GO:0052735 tRNA (cytidine-3-)-methyltransferase activity Molecular Function |
| KEGG gene cross-reference | ddi:DDB_G0274197 hsa:131965 mmu:67011 pon:100171853 rno:290564 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.