LXL04_023555 | RubberDandelionOmics

Gene overview

LXL04_023555

Reference: OH-1004 Chr: Chr05 Coordinates: 50124602-50125397 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

372 bp · LXL04_023555|LXL04_023555|OH1004|cDNA

ATGGATCGGTATCAGGGGGTAGAGAAGCCAAGGACCGATGCCCCGATTAACGAGAATGAGATTAGTATAACCACTCAAGGGAGGATGCGGAATTACATTACTTACGCCATTACTCTTGTCCAGGAAAAAGGATCCGATGAGATTTCTCTCAAGGCCATGAGGAGAGCTATTAACAAAACTGTTATGATAGCTGAATTAATTAAGAGAAGGATTGCTGGTCTCCATCAAATTACATCTTTAGGTTCTGCCGACATAACTGA...

CDS

Download CDS FASTA

372 bp · LXL04_023555|LXL04_023555|OH1004|CDS

ATGGATCGGTATCAGGGGGTAGAGAAGCCAAGGACCGATGCCCCGATTAACGAGAATGAGATTAGTATAACCACTCAAGGGAGGATGCGGAATTACATTACTTACGCCATTACTCTTGTCCAGGAAAAAGGATCCGATGAGATTTCTCTCAAGGCCATGAGGAGAGCTATTAACAAAACTGTTATGATAGCTGAATTAATTAAGAGAAGGATTGCTGGTCTCCATCAAATTACATCTTTAGGTTCTGCCGACATAACTGA...

Protein

Download Protein FASTA

123 aa · LXL04_023555|LXL04_023555|OH1004|PROTEIN

MDRYQGVEKPRTDAPINENEISITTQGRMRNYITYAITLVQEKGSDEISLKAMRRAINKTVMIAELIKRRIAGLHQITSLGSADITDMWEQLEEGLLPLETTRHVSVITITLSRKELDTSASG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_023555`
TK1151 ID	TkA06G258410
OH-1004 ID	LXL04_023555
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 99.194 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_023555`
Location	Chr05:50124602-50125397 (-)
Description	Similar to Rpp25l: Ribonuclease P protein subunit p25-like protein
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_023555` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0001682 tRNA 5'-leader removal Biological Process GO:0006364 rRNA processing Biological Process GO:0006396 RNA processing Biological Process GO:0006417 regulation of translation Biological Process GO:0000172 ribonuclease MRP complex Cellular Component GO:0000781 chromosome, telomeric region Cellular Component GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005730 nucleolus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0030681 multimeric ribonuclease P complex Cellular Component GO:0003677 DNA binding Molecular Function
KEGG gene cross-reference	bta:512203 hsa:138716 hsa:54913 mmu:69961 pfa:PF3D7_0814200 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.738

Rank 1 · LXL04_023555 · OH-1004

Nucleus0.263

Rank 2 · LXL04_023555 · OH-1004

Endoplasmic reticulum0.108

Rank 3 · LXL04_023555 · OH-1004

Mitochondrion0.070

Rank 4 · LXL04_023555 · OH-1004

Plastid0.055

Rank 5 · LXL04_023555 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01918.28Alba19-82 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_023555	`PF01918.28`	Alba	19	82	2.1e-17	63.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card